DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh1a2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001039196.1 Gene:aldh1a2 XenbaseID:XB-GENE-1012909 Length:511 Species:Xenopus tropicalis

Alignment Length:483 Identity:268/484 (55%)
Similarity:363/484 (75%) Gaps:2/484 (0%)


  Fly    27 AQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWR 91
            |..|..:.::|||||:..|.||:||..:||||.::|.:|.|.:|||:|.||:||:.||...|.||
 Frog    24 ANLEVKHTKIFINNEWQTSESGRTFPVYNPATGEQICEVQEAEKADVDKAVQAARLAFSLGSVWR 88

  Fly    92 KLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALF-DVTYSILTLQYYAGWTDKFFGD 155
            ::...:|..|::||..|::|::..||:||:.::|||:.::.: |:..:|.|.:|||||.||..|.
 Frog    89 RMDASERGRLLDKLADLVERERTTLATLESLNSGKPFLQSYYVDLQGAIKTFRYYAGWADKIHGL 153

  Fly   156 TIPA-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAAL 219
            |||| |.:::.||.||:||.|||||||:||||.|||..|||..|.|:::|||||||||||:|.||
 Frog   154 TIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGAL 218

  Fly   220 AKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGK 284
            .||||||.||:|::.|:||:||.||::|..|.|||||||.|:|.::.:||..||||||:||||||
 Frog   219 IKEAGFPPGVVNILPGYGPSAGTAIASHIGIDKVAFTGSTEVGMLIQEAAGKSNLKRVTLELGGK 283

  Fly   285 SPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQ 349
            ||.::|.|||:|:|||..|:.:|.|.||.|.|||||:|.:.||:|||.::..:||.|.||:||:.
 Frog   284 SPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPFDP 348

  Fly   350 NVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFG 414
            ..:||||.|.....|:|..|:||..|||||:.|||.:|..|||:||||||:|:|:||||:|||||
 Frog   349 TTEQGPQTDKKQYNKILELIQSGIAEGAKLECGGKGLGRKGFFIEPTVFSNVRDEMRIAREEIFG 413

  Fly   415 PVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGG 479
            |||.|.:|.::||:|:||||..|||.|.|.||||||||..::.:.||:||||||:|:...:||||
 Frog   414 PVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGG 478

  Fly   480 YKHSGIGRELGKDGLDNYLETKTITMKL 507
            ||.||.|||:|:.||..|.|.||:|:|:
 Frog   479 YKMSGNGREMGEYGLREYTEAKTVTIKI 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 265/475 (56%)
aldh1a2NP_001039196.1 ALDH_F1AB_F2_RALDH1 25..505 CDD:143459 266/480 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99602563
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.