DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh1b1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_082546.1 Gene:Aldh1b1 MGIID:1919785 Length:519 Species:Mus musculus

Alignment Length:483 Identity:283/484 (58%)
Similarity:362/484 (75%) Gaps:6/484 (1%)


  Fly    31 PN----YCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWR 91
            ||    |.:||||||:.|:||.|||.|.||.|.:.|..|:|||:||:|||||||::||...|.||
Mouse    32 PNPEICYNKLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWR 96

  Fly    92 KLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGD 155
            ::...:|..|:|:|..|::||:.:||||||.|||||:.|: :.|:...|...:|:|||.||:.|.
Mouse    97 RMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGK 161

  Fly   156 TIPAGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAAL 219
            |||..| ....||.|||||.|||||||:||:|..||..||||.|.|::||.||||||:||::|:|
Mouse   162 TIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASL 226

  Fly   220 AKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGK 284
            .||||||.||:|::.|:||||||||:.|.|:.|||||||.|:|.::.:||..||||||:||||||
Mouse   227 IKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGK 291

  Fly   285 SPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQ 349
            ||.:|..|||::.||:..|||||.|.||.|||||||:|.|.||.||:.:...|||.||||||||.
Mouse   292 SPSIVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFEL 356

  Fly   350 NVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFG 414
            :.|||||:|.:...::||||..|:||||||..||:|:|..|||::||||.||:|.||||:|||||
Mouse   357 DTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIFG 421

  Fly   415 PVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGG 479
            |||.:|||..:||:|.||||.:|||||.|.|.|::||:.|...:.||:||:|.|:.|...|||||
Mouse   422 PVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTCHTPFGG 486

  Fly   480 YKHSGIGRELGKDGLDNYLETKTITMKL 507
            :|.||.|||||:|||..|.|.||:|:|:
Mouse   487 FKESGNGRELGEDGLRAYTEVKTVTIKV 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 280/475 (59%)
Aldh1b1NP_082546.1 PLN02466 22..518 CDD:215259 283/484 (58%)
ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 281/480 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99482924
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.