DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh16a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_666066.1 Gene:Aldh16a1 MGIID:1916998 Length:802 Species:Mus musculus

Alignment Length:500 Identity:144/500 (29%)
Similarity:236/500 (47%) Gaps:58/500 (12%)


  Fly     7 KLLAHQLAVSRKWSKFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKA 71
            :||.|.  |:..|.|.:|.    .|..||                   :|.|.:.:....:.:..
Mouse    38 RLLGHH--VNGMWLKPEHR----NPAPCQ-------------------DPITGENLASCLQAEAE 77

  Fly    72 DIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDV 135
            ||..||:|||.||   ..|.:|....|...:.:|..::.:.:..|.:||:...|:...|.. .||
Mouse    78 DIAAAVEAAKIAF---KAWSQLPGAARGQHLTRLAKVVQKHQRLLWTLESLVTGRAVREVRDGDV 139

  Fly   136 TYSILTLQYYAGWTDKFFGDTIPAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCT 200
            ..:...|||:|..... .||        ::...:||||:|.|:|..:..|.:.|:..||||:|||
Mouse   140 PLAQQLLQYHAVQAHA-QGD--------ALADWQPVGVIGLILPTPFSFLDMMWRVCPALAMGCT 195

  Fly   201 II--MKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTA-GAAISAHPDIAKVAFTGSVEIG 262
            ::  :.||..|||.   :|.||.|.|...|::|||  .||.: |..:::.|.:.||||.|:||.|
Mouse   196 VVALVPPAFPTPLL---LAQLAGELGSFPGILNVV--CGPASLGPVLASQPGVQKVAFCGAVEEG 255

  Fly   263 RIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIY 327
            |::.:..|....: :.|.||.:|.:::.|.||:|.|||...:|::|:..   ..|.|..:.|.::
Mouse   256 RVLRRTLAGRGAE-LGLALGTESLLLLMDSADVDSAVEGVVDAVWSDRS---LGGLRLLIQESVW 316

  Fly   328 DEFVAKAAAKAKARKVGNPFEQNVQQGPQ--IDDDMLTKVLGYIESGKKEGAKL-QAGGKRIGNV 389
            ||.:.:..|:....:.|...:..|..|.:  ...|:   ...:::..:.:|.:: |||.  :.:.
Mouse   317 DEAMRRLQARMAQIRSGRGLDGAVDMGARGAAARDL---AQSFVDEAQSQGGQVFQAGD--VPSS 376

  Fly   390 GFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKF 454
            ..|..|.:.|.:......||.|:..||.....|.:::|.:..||....|.:|.|.:..:.:||:.
Mouse   377 SPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALANGTPRGGSASVWSERLGQALEL 441

  Fly   455 ANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLE 499
            ...:..|:||||.:....|:.|.||.|.||.....|.|||..||:
Mouse   442 GYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDGLYEYLQ 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 136/474 (29%)
Aldh16a1NP_666066.1 ALDH-SF 19..491 CDD:299846 144/500 (29%)
ALDH-SF 527..>765 CDD:299846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99632775
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.