DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh8a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001178017.2 Gene:Aldh8a1 RGDID:1590218 Length:487 Species:Rattus norvegicus

Alignment Length:477 Identity:177/478 (37%)
Similarity:266/478 (56%) Gaps:22/478 (5%)


  Fly    40 NEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNK 104
            |.::||        ::|:|.:...:|....|.:|::||:||::||   ..|...||.:|:.::|:
  Rat    22 NSYIDS--------YDPSTGEVYCKVPNSGKEEIEVAVQAAREAF---PAWSSRSPQERSLILNR 75

  Fly   105 LCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGDTIPAG--GFVSMT 166
            :..::::....||..|::|.||....| ..|:..|:|..:::|........|.....  |.:..|
  Rat    76 VADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSIQHHVSDCTEMSHLGCMHYT 140

  Fly   167 RKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVIN 231
            .:.|||:.|.|.|||.||.:|.||..||:|.|.|:|.||:|.|.:||.....|..:||.|.||||
  Rat   141 VRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSELTSVTAWMFCKLLDKAGVPPGVIN 205

  Fly   232 VVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADID 296
            ||.|.||..|.|:.:||::..::||||......:.|.:| .:.|::|||||||:|.::|:||:::
  Rat   206 VVFGTGPRVGEALVSHPEVPVISFTGSQPTAERITQLSA-PHCKKLSLELGGKNPAIIFEDANLE 269

  Fly   297 FAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDM 361
            ..:..|..:.|:|.|:.|...||.:|...||:||:.:.....:..|||.|.:.:...|..|....
  Rat   270 ECIPATVRSSFANQGEICLCTSRIFVQRSIYNEFLKRFVEATRKWKVGIPSDPSANMGALISKAH 334

  Fly   362 LTKVLGYIESGKKEGAKLQAG------GKRIGN-VGFFVEPTVFSDVKDDMRIAQEEIFGPVQSI 419
            |.||..|:.....||||:..|      ...:.| .|:|:.|||.:|:||:.....|||||||..:
  Rat   335 LEKVRSYVTKAHAEGAKILCGEGVDQLSLPLRNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCV 399

  Fly   420 FKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSG 484
            ..|.|.||:|.|||.|:|||.|.|.:.|:.:..:.|..:.:|.||.||:.....:.||||.|.||
  Rat   400 VPFDSEEEVIARANGVKYGLGATVWSKDVGRIHRVAKRLQSGLVWTNCWLIRELNLPFGGMKSSG 464

  Fly   485 IGRELGKDGLDNYLETKTITMK 506
            ||||..||..|.:.|.||||:|
  Rat   465 IGREGAKDSYDFFTEIKTITIK 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 176/476 (37%)
Aldh8a1NP_001178017.2 ALDH_F8_HMSADH 27..485 CDD:143412 174/470 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.