DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh1a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001027486.1 Gene:aldh1a1 XenbaseID:XB-GENE-987058 Length:502 Species:Xenopus tropicalis

Alignment Length:480 Identity:275/481 (57%)
Similarity:356/481 (74%) Gaps:2/481 (0%)


  Fly    30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLS 94
            |..|.::|||||:.:|||||.|..:||||.::|.:|.||||.|::.|||||::||...|.||:|.
 Frog    18 EIKYRKIFINNEWHNSVSGKKFPVYNPATGEKICEVEEGDKEDVNKAVKAAREAFQIGSPWRRLD 82

  Fly    95 PLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALF-DVTYSILTLQYYAGWTDKFFGDTIP 158
            ..:|..::|||..|::||::.|:::|:.|.|||:|.:.: |:..:|.:|:|.|||.||..|.|||
 Frog    83 ASERGRILNKLADLVERDRSILSTMESIDGGKPFAASYYGDIPGAIKSLRYCAGWADKNQGRTIP 147

  Fly   159 A-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKE 222
            . |.:.:.||.|||||.|||||||:||:|.|||..|||..|.|:::|||||||||||:|.:|.||
 Frog   148 MDGDYFTFTRHEPVGVCGQIIPWNFPLVMFAWKIAPALCCGNTVVIKPAEQTPLTALYMGSLIKE 212

  Fly   223 AGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPV 287
            ||.|.||:|:|.|:||||||||:.|.:|.|||||||.|:|:::.:||..||||||:||||||||.
 Frog   213 AGIPPGVVNIVPGYGPTAGAAIAYHMEIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPN 277

  Fly   288 VVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQ 352
            ::|.|||:|.|||..|..||.:.||.|.||||.:|.|.||||||.|:..:||.|.:|:|....|.
 Frog   278 IIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPLSPCVN 342

  Fly   353 QGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQ 417
            ||||||.|...|:|..|||||||||||:.||...|..||::.||||||||||||||:||||||||
 Frog   343 QGPQIDKDQFDKILELIESGKKEGAKLECGGSAWGEKGFYISPTVFSDVKDDMRIAKEEIFGPVQ 407

  Fly   418 SIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKH 482
            .|.||..::|:|.||||..|||||||.|.|::||:..:..:.||:||||||.|:.|.:||||:|.
 Frog   408 QILKFKRIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTALQAGTVWINCYSAMSPQSPFGGFKM 472

  Fly   483 SGIGRELGKDGLDNYLETKTITMKL 507
            ||.|||:|:.||..|.|.||:.||:
 Frog   473 SGNGREMGEYGLHEYTEVKTVIMKI 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 273/475 (57%)
aldh1a1NP_001027486.1 ALDH_F1AB_F2_RALDH1 16..496 CDD:143459 274/478 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99640180
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.