DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh9a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_064377.2 Gene:Aldh9a1 MGIID:1861622 Length:518 Species:Mus musculus

Alignment Length:476 Identity:181/477 (38%)
Similarity:284/477 (60%) Gaps:18/477 (4%)


  Fly    41 EFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKL 105
            |.||: || |...|.|||.:.|...:...:.:::|||:.||.||   ..|.|.|.|:|..::.:.
Mouse    45 EPVDA-SG-TEKAFEPATGRVIATFACSGEKEVNLAVENAKAAF---KLWSKKSGLERCQVLLEA 104

  Fly   106 CALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTI--PAGGFVSMTRK 168
            ..::...|..:|::||.:|||...||..||......|:||||......|:.|  |.|.| ..||:
Mouse   105 ARIIKERKDEIATVETINNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQLPGGSF-GYTRR 168

  Fly   169 EPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVV 233
            ||:||...|..||||..:..||..||||.|..:|.||:..||::||.:|.:..:||.|.|:.|||
Mouse   169 EPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVV 233

  Fly   234 NGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFA 298
            .| |...|..:..|.::||::|||||..|..:|:.:| ..:|.::||||||||:::|.|.:::.|
Mouse   234 QG-GAATGQFLCHHREVAKISFTGSVPTGVKIMEMSA-KGVKPITLELGGKSPLIIFSDCNMENA 296

  Fly   299 VETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLT 363
            |:....|.|...||.||.|:|.:|.::|.|:|:.:...:.:..|:|:|..::.:.||.|:...|.
Mouse   297 VKGALMANFLTQGQVCCNGTRVFVQKEIADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHLE 361

  Fly   364 KVLGYIESGKKEGAKLQAGGK-------RIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFK 421
            :|||:::..|::||.:..||:       ::.: |:::.|.:.::.:|||...:|||||||.||..
Mouse   362 RVLGFVKLAKEQGATVLCGGEVYVPEDPKLKH-GYYMTPCILTNCRDDMTCVKEEIFGPVMSILT 425

  Fly   422 FSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIG 486
            |.:..|:::|||:..:||||||.|.||.:|.:.|..:.||:.:||.|:......||||||.||.|
Mouse   426 FGTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELPFGGYKKSGFG 490

  Fly   487 RELGKDGLDNYLETKTITMKL 507
            ||.|:..::.|.:.||:.:::
Mouse   491 RENGRVTIEYYSQLKTVCVEM 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 181/474 (38%)
Aldh9a1NP_064377.2 ALDH_F9_TMBADH 55..512 CDD:143409 175/465 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.