DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh16a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001073423.2 Gene:aldh16a1 ZFINID:ZDB-GENE-070112-2062 Length:795 Species:Danio rerio

Alignment Length:497 Identity:132/498 (27%)
Similarity:207/498 (42%) Gaps:63/498 (13%)


  Fly    14 AVSRKW-SKFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSE--GDKADIDL 75
            |.::.| .|...|..        .||:.:|......:|....:   ||..|..|.  ....|:..
Zfish    26 ATAQSWLEKHSRTLG--------FFIDGKFSHPADRQTQDVID---SKAAVVCSTVCAQAEDVAS 79

  Fly    76 AVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASL--ETQDNGKPYAEALFDVTYS 138
            ||.:|...|   ..|.:||..||..::.||..::.|....::.:  .:|....|        ...
Zfish    80 AVSSAAAGF---KTWSQLSCYQRAKVLLKLPGVLQRHSQCVSEVCELSQSTTSP--------AVL 133

  Fly   139 ILTLQYYAGWTDKFFGDTIPAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIM 203
            |...||||.|..  ..||       .|....|.|||..::..:..:..|..|..||||:|..:|:
Zfish   134 IRLAQYYASWAQ--LRDT-------RMPEWSPQGVVTVVVSDDCSVYFLLLKVLPALAMGNAVIV 189

  Fly   204 KPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQA 268
            .|.:.|.|..|.:|.|..|||.||||:||:.|...:..|.::.:|.:..:.|:|..:.|..|.:|
Zfish   190 VPGKTTALPGLLLAQLFMEAGMPAGVLNVLTGSEASLAAKMAQNPQVNYLTFSGCRQTGEAVAKA 254

  Fly   269 AATSNLKRV-SLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTY-----VHEKIY 327
            ||...:... ||......|.::|:.||:|.||:...|..|..        .|.:     |.|.:.
Zfish   255 AAGWGVPMTFSLSSSSVCPFIIFESADLDSAVDGVIELAFKK--------KRDFQWVLCVQESVL 311

  Fly   328 DEFVAKAAAK-AKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGF 391
            |..||:...: |:.:.|           |...|...:.:...|:..:::||.|..........|.
Zfish   312 DSVVARLKTRMAEMKGV-----------PLASDPDRSIIDAAIQEAQQQGATLIQSCPPASTGGL 365

  Fly   392 FVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFAN 456
            : .|||...:............|||..:..|.|..|.:...|:..:|.||.:.|.|:..||:.|.
Zfish   366 Y-PPTVLCGLAPSCESVISPPPGPVLPLITFRSSAEGVTLGNHSPHGQAASIWTEDLTLALESAK 429

  Fly   457 NVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYL 498
            ::..||||:||:..:.|:.|..|.:.||...:.|::||..:|
Zfish   430 SLCVGSVWVNCHSVMDPALPLCGRRDSGNCTDGGREGLYQFL 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 128/478 (27%)
aldh16a1NP_001073423.2 ALDH-SF 18..470 CDD:299846 131/495 (26%)
AdhE 514..>755 CDD:223944
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99631864
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.