DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001004907.1 Gene:aldh2 XenbaseID:XB-GENE-490836 Length:521 Species:Xenopus tropicalis

Alignment Length:478 Identity:293/479 (61%)
Similarity:362/479 (76%) Gaps:2/479 (0%)


  Fly    32 NYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPL 96
            ::.|||||||:.|:.|.|||.|.||:|.:.|..|:||||||:|.|||||::||...|.||::...
 Frog    39 HFNQLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDAS 103

  Fly    97 QRTNLMNKLCALMDRDKAFLASLETQDNGKPYA-EALFDVTYSILTLQYYAGWTDKFFGDTIPA- 159
            ||..|:|:|..|::||:|.||:|||.||||||| ....|:...:..|:|||||.||..|.|||. 
 Frog   104 QRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPID 168

  Fly   160 GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAG 224
            |.:.:.||.|||||.|||||||:||||||||:|||||.|..|:||.||||||||||:|:|.||||
 Frog   169 GDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAG 233

  Fly   225 FPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVV 289
            ||.||:|::.|.|||||||||:|.|:.|||||||.|:||::.|||..||||:|:||||||||.::
 Frog   234 FPPGVVNIITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGKSNLKKVTLELGGKSPNII 298

  Fly   290 FDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQG 354
            |.|||:|:|||..|.|||.|.||.|||||||||.|.||:|||.::..:||.|.|||||:...:||
 Frog   299 FSDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKTEQG 363

  Fly   355 PQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSI 419
            ||:|::...||||||:|||||||||..||....:.|:|::||||.||.|:|.||:|||||||..|
 Frog   364 PQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREEIFGPVMQI 428

  Fly   420 FKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSG 484
            .||.|:||:||||||..|||||.|.|.||:||...:.:|.||:|||||||......||||:|.||
 Frog   429 LKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVFGAQAPFGGFKASG 493

  Fly   485 IGRELGKDGLDNYLETKTITMKL 507
            ||||||:.||:.|.|.|.||:|:
 Frog   494 IGRELGEYGLEAYTEVKNITIKI 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 292/475 (61%)
aldh2NP_001004907.1 ALDH_F1AB_F2_RALDH1 35..515 CDD:143459 292/476 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.