DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh9a1b

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_009295330.1 Gene:aldh9a1b ZFINID:ZDB-GENE-040120-5 Length:539 Species:Danio rerio

Alignment Length:503 Identity:180/504 (36%)
Similarity:283/504 (56%) Gaps:28/504 (6%)


  Fly    24 HTYAQCEPN-----------YCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAV 77
            |.:.:|..:           :|...::   :..|..|:...|.|||.:.:.::.....|::|.||
Zfish    39 HPWTRCASSGTLQIKDPLNFWCGARVD---LKDVKTKSEPVFEPATGRVLCRLQTCGSAEVDAAV 100

  Fly    78 KAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTL 142
            :.|..||   ..|||||.::|..:|.:...|:::.:..:|.:|..:|||...||..||..:.|::
Zfish   101 RNASAAF---KVWRKLSGMERARVMLEAARLIEKRREEIAEMEVINNGKSITEARLDVDSARLSI 162

  Fly   143 QYYAGWTDKFFGD--TIPAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKP 205
            :|:||......|.  .:|.|.| :.||:||.||...|..||||..:.|||..||:|.|.:::.||
Zfish   163 EYFAGQATTLSGQHVQLPGGSF-AYTRREPFGVCVGIGAWNYPFQIAAWKSAPAIACGNSMVFKP 226

  Fly   206 AEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAA 270
            :..||:||:.:|.:.::||.|.|:.|||.| |...|:.:..||.:.||:|||||..|:.:|: .|
Zfish   227 SPLTPVTAVLLAEIYRQAGAPEGLFNVVQG-GQETGSLLCLHPSVEKVSFTGSVPTGKKIME-MA 289

  Fly   271 TSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAA 335
            :..:|.|:||||||||:::|:|.|::.||.....|.|.:.||.|..|:|.:|...|..:|:.:..
Zfish   290 SRGVKAVTLELGGKSPLIIFEDTDLENAVRGALMANFLSQGQVCSNGTRVFVQSSIVPQFLKEVV 354

  Fly   336 AKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNV------GFFVE 394
            .:.||..:|:|.....:.|..:....|.|||.|:|..|.|||::..||:.....      |:::.
Zfish   355 RRTKAISIGDPLLDETRMGALVSKAHLDKVLRYVEQAKNEGAQVLCGGEPFSPADPKLKDGYYMT 419

  Fly   395 PTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVD 459
            |.|.....|||...:|||||||.|:..|.:.:|::.|||:...||||||.|.|:.:|.:...|:.
Zfish   420 PCVLDSCTDDMTCVKEEIFGPVMSVLTFDTEDEVLRRANDSDLGLAAGVFTKDVKRAHRVIENLQ 484

  Fly   460 AGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            |||.:||.|:......||||:|.||||||.|:..::.|.:.||:.:::
Zfish   485 AGSCFINNYNITPVEVPFGGFKASGIGRENGQVTIEFYSQLKTVVVEM 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 178/481 (37%)
aldh9a1bXP_009295330.1 ALDH_F9_TMBADH 76..533 CDD:143409 175/464 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99098629
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.