DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh2.2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_998466.2 Gene:aldh2.2 ZFINID:ZDB-GENE-030326-5 Length:516 Species:Danio rerio

Alignment Length:482 Identity:280/483 (58%)
Similarity:363/483 (75%) Gaps:2/483 (0%)


  Fly    28 QCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRK 92
            |.:.:|.::|||||:.|:||.|||.|.||||.:.|..|:||||||:|.|||||:.||...|.||:
Zfish    30 QPDVHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSPWRR 94

  Fly    93 LSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILTLQYYAGWTDKFFGDT 156
            :...||..|:::|...::||.|:||.|||.|||||||.:. .||...:..::|||||.||:.|.|
Zfish    95 MDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKT 159

  Fly   157 IPA-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALA 220
            ||. |.:...||.||:||.|||||||:||||.|||.|||||.|.|::||.|||||||||::|:|.
Zfish   160 IPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLI 224

  Fly   221 KEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKS 285
            ||.||||||:|:|.|.||||||||::|.|:.|||||||.::|.::.:|::.||||:|:|||||||
Zfish   225 KEVGFPAGVVNIVPGMGPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKS 289

  Fly   286 PVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQN 350
            |.::..||:::.|||.:|.|||.|.||.||||:||:|.|.||||||.::..:||.|.||:||:.|
Zfish   290 PNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLN 354

  Fly   351 VQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGP 415
            .:||||:::|...||||||.|||:|||||..||......|:|::||||.||||||.||:||||||
Zfish   355 TEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGP 419

  Fly   416 VQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGY 480
            |..|.||.||||:|:|||:.:||||..|.|.||:||...::.:.||:||||||:......|||||
Zfish   420 VMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGY 484

  Fly   481 KHSGIGRELGKDGLDNYLETKTITMKL 507
            |.||||||:|:.||:||.|.||:|:|:
Zfish   485 KASGIGREMGEYGLENYTEVKTVTIKV 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 278/475 (59%)
aldh2.2NP_998466.2 ALDH_F1AB_F2_RALDH1 30..510 CDD:143459 279/480 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.