DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001260290.1 Gene:Aldh FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster

Alignment Length:485 Identity:271/486 (56%)
Similarity:358/486 (74%) Gaps:6/486 (1%)


  Fly    28 QCEPN--YCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEW 90
            |..|:  |..:|||||:..|.|||.|.|.||.|::.|.::...||.|||:||:||:.||...|.|
  Fly    32 QTTPDILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPW 96

  Fly    91 RKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILTLQYYAGWTDKFFG 154
            |::...:|..|:.:|..||:||:.:||||||.||||||:.:. .|:..:|..|:|:|||.||..|
  Fly    97 RRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNHG 161

  Fly   155 DTIPA-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAA 218
            .|||. |.|.:.||.|||||.|||||||:|:||:|||.|||||.|.||::||||||.||||::|.
  Fly   162 KTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQ 226

  Fly   219 LAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGG 283
            |.||||||.||:|||.||| |||||::.|.|:.|||||||.::|:::..|:..:|||||:|||||
  Fly   227 LVKEAGFPEGVVNVVPGFG-TAGAALANHCDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGG 290

  Fly   284 KSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFE 348
            |||.::..|.|:|:||||.|..||.|.||.|||||||:|.:|||||||.::|.:||.|.|||||:
  Fly   291 KSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFD 355

  Fly   349 QNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKR-IGNVGFFVEPTVFSDVKDDMRIAQEEI 412
            .|.:||||::::.:.|:||.|::|||:||||.|||.| .|..|:||:||||:||:|||.||:|||
  Fly   356 LNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEI 420

  Fly   413 FGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPF 477
            |||||.:.:|..|:|:|:||||.:|||||.|.|.|::||......:.||:||:|.|:.:....||
  Fly   421 FGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPF 485

  Fly   478 GGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            ||||.||.|||.|:..|.||.|.|::.:|:
  Fly   486 GGYKMSGHGRENGEYALSNYTEVKSVIVKV 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 268/476 (56%)
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 270/481 (56%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 269/481 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99223777
eggNOG 1 0.900 E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 472 1.000 Inparanoid score I227
Isobase 1 0.950 0 Normalized mean entropy S334
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 P PTHR11699
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2025
98.870

Return to query results.
Submit another query.