DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh1a3

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_695212.1 Gene:Aldh1a3 RGDID:628662 Length:512 Species:Rattus norvegicus

Alignment Length:480 Identity:267/481 (56%)
Similarity:352/481 (73%) Gaps:2/481 (0%)


  Fly    30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLS 94
            |..:.::||||::.:..||:.|||:||:|.::|.:|.||||.|:|.||:||:.||.|.|.||:|.
  Rat    28 EVKFTKIFINNDWHEPKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLD 92

  Fly    95 PLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALF-DVTYSILTLQYYAGWTDKFFGDTIP 158
            .|.|..|:::|..|::||:|.||:|||.|.|||:..|.| |:...|.|.:|:|||.||..|.|||
  Rat    93 ALSRGQLLHQLADLIERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIP 157

  Fly   159 A-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKE 222
            . ...:..||.||:||.|.|.|||:||||||||..|||..|.|:::|||||||||||::|:|.||
  Rat   158 TDDNVMCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKE 222

  Fly   223 AGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPV 287
            .|||.||:|:|.|||||.|||||:||.|.|:|||||.|:|::|.:||:.||||||:|||||::|.
  Rat   223 VGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGRNPC 287

  Fly   288 VVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQ 352
            :|..|||:|.|||..|:.:|.|.||.|.|.||.:|.|::|.|||.::...||.|.||:||:...:
  Rat   288 IVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRPVGDPFDAKTE 352

  Fly   353 QGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQ 417
            ||||||.....|:|..|||||||||||:.||..:.:.|.|::|||||||.|:||||:||||||||
  Rat   353 QGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVTDNMRIAKEEIFGPVQ 417

  Fly   418 SIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKH 482
            .|.||.:|||:|.|||:..|||.|.|.|.:::||||.|:.:::|:||:|||:|.....||||:|.
  Rat   418 PILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWVNCYNAFYAQAPFGGFKM 482

  Fly   483 SGIGRELGKDGLDNYLETKTITMKL 507
            ||.|||||:..|..|.|.||:|:||
  Rat   483 SGNGRELGEYALAEYTEVKTVTIKL 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 264/475 (56%)
Aldh1a3NP_695212.1 PLN02466 19..512 CDD:215259 267/481 (56%)
ALDH_F1AB_F2_RALDH1 26..506 CDD:143459 265/478 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.