DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh1a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_071852.2 Gene:Aldh1a1 RGDID:2087 Length:501 Species:Rattus norvegicus

Alignment Length:489 Identity:280/490 (57%)
Similarity:355/490 (72%) Gaps:11/490 (2%)


  Fly    21 KFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFH 85
            |..||         ::|||||:.||||||.|...||||.:.|..|.||||||:|.|||||::||.
  Rat    17 KIQHT---------KIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQ 72

  Fly    86 RDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWT 149
            ..|.||.:...:|..|:|||..||:||:..||::|..:.||.:|.| |.|:..||..|:|.|||.
  Rat    73 IGSPWRTMDASERGRLLNKLADLMERDRLLLATIEAINGGKVFANAYLSDLGGSIKALKYCAGWA 137

  Fly   150 DKFFGDTIPAGGFV-SMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTA 213
            ||..|.|||:.|.: :.||:||:||.|||||||:||||..||.||||:.|.|:::||||||||||
  Rat   138 DKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWNFPLLMFIWKIGPALSCGNTVVVKPAEQTPLTA 202

  Fly   214 LHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVS 278
            ||||:|.||||||.||:|:|.|:|||||||||:|.|:.|||||||.::|:::.:||..||||||:
  Rat   203 LHMASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVT 267

  Fly   279 LELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKV 343
            ||||||||.:||.|||:|.|||..|..:|.:.||.|.|.||.:|.|.:|||||.|:..:||...:
  Rat   268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERAKKYVL 332

  Fly   344 GNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIA 408
            |||..|.:.||||||.:...|:|..|||||||||||:.||.|.||.||||:|||||:|.|:||||
  Rat   333 GNPLTQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIA 397

  Fly   409 QEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLP 473
            :||||||||.|.||.|::::|.||||..|||||||.|.|:::|:..::.:.||.||:|||..:..
  Rat   398 KEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNCYMILSA 462

  Fly   474 STPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            ..||||:|.||.|||||:.||..|.|.||:.||:
  Rat   463 QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 276/475 (58%)
Aldh1a1NP_071852.2 ALDH_F1AB_F2_RALDH1 15..495 CDD:143459 279/487 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99640369
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.