DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALDH9A1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_000687.3 Gene:ALDH9A1 HGNCID:412 Length:518 Species:Homo sapiens

Alignment Length:467 Identity:178/468 (38%)
Similarity:278/468 (59%) Gaps:16/468 (3%)


  Fly    50 TFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKA 114
            |...|.|||.:.|...:...:.:::|||:.||.||   ..|.:.|.::|..::.:...::...:.
Human    52 TEKAFEPATGRVIATFTCSGEKEVNLAVQNAKAAF---KIWSQKSGMERCRILLEAARIIRERED 113

  Fly   115 FLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTI--PAGGFVSMTRKEPVGVVGQI 177
            .:|::|..:|||...||..|:..|...|:||||......|:.|  |.|.| ..||:||:||...|
Human   114 EIATMECINNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSF-GYTRREPLGVCVGI 177

  Fly   178 IPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGA 242
            ..||||..:.:||..||||.|..::.||:..||::||.:|.:..|||.|.|:.|||.| |...|.
Human   178 GAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQG-GAATGQ 241

  Fly   243 AISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALF 307
            .:..|||:|||:|||||..|..:|:.:| ..:|.|:||||||||:::|.|.|::.||:....|.|
Human   242 FLCQHPDVAKVSFTGSVPTGMKIMEMSA-KGIKPVTLELGGKSPLIIFSDCDMNNAVKGALMANF 305

  Fly   308 SNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESG 372
            ...||.||.|:|.:|.::|.|:|..:...:.:..|:|:|..::.:.||.|:...|.:|||:::..
Human   306 LTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVA 370

  Fly   373 KKEGAKLQAGG-------KRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMID 430
            |::|||:..||       .::.: |:::.|.|.::.:|||...:|||||||.||..|.:..|:::
Human   371 KEQGAKVLCGGDIYVPEDPKLKD-GYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLE 434

  Fly   431 RANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLD 495
            |||:..:||||||.|.||.:|.:....:.||:.:||.|:......||||||.||.|||.|:..::
Human   435 RANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIE 499

  Fly   496 NYLETKTITMKL 507
            .|.:.||:.:::
Human   500 YYSQLKTVCVEM 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 178/465 (38%)
ALDH9A1NP_000687.3 ALDH_F9_TMBADH 55..512 CDD:143409 177/465 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99611008
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.