DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALDH1A1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_000680.2 Gene:ALDH1A1 HGNCID:402 Length:501 Species:Homo sapiens

Alignment Length:477 Identity:278/478 (58%)
Similarity:352/478 (74%) Gaps:2/478 (0%)


  Fly    33 YCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQ 97
            |.::|||||:.||||||.|..|||||.:|:.||.||||.|:|.|||||::||...|.||.:...:
Human    20 YTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASE 84

  Fly    98 RTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGDTIPA-G 160
            |..|:.||..|::||:..||::|:.:.||.|:.| |.|:...|.||:|.|||.||..|.|||. |
Human    85 RGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDG 149

  Fly   161 GFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGF 225
            .|.:.||.||:||.|||||||:||:||.||.||||:.|.|:::||||||||||||:|:|.|||||
Human   150 NFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGF 214

  Fly   226 PAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVF 290
            |.||:|:|.|:|||||||||:|.||.|||||||.|:|:::.:||..||||||:||||||||.:|.
Human   215 PPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVL 279

  Fly   291 DDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGP 355
            .|||:|.|||..|..:|.:.||.|.|.||.:|.|.||||||.::..:||...:|||....|.|||
Human   280 ADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGP 344

  Fly   356 QIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIF 420
            |||.:...|:|..|||||||||||:.||...||.|:||:|||||:|.|:||||:||||||||.|.
Human   345 QIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIM 409

  Fly   421 KFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGI 485
            ||.||:::|.||||..|||:|||.|.||:||:..::.:.||:||:|||..|....||||:|.||.
Human   410 KFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGN 474

  Fly   486 GRELGKDGLDNYLETKTITMKL 507
            |||||:.|...|.|.||:|:|:
Human   475 GRELGEYGFHEYTEVKTVTVKI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 277/475 (58%)
ALDH1A1NP_000680.2 ALDH_F1AB_F2_RALDH1 15..495 CDD:143459 277/475 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99640341
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2025
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.