DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and alh-2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_503467.2 Gene:alh-2 WormBaseID:WBGene00000108 Length:514 Species:Caenorhabditis elegans

Alignment Length:483 Identity:283/484 (58%)
Similarity:366/484 (76%) Gaps:2/484 (0%)


  Fly    27 AQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWR 91
            |..:|.|..|||||||||:.|||||...|||..|.:.:|:||::.|:|:||:||||||...||||
 Worm    27 ADFKPKYTSLFINNEFVDAKSGKTFEFVNPANGKLLAKVAEGNRDDVDIAVEAAKKAFKIGSEWR 91

  Fly    92 KLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILTLQYYAGWTDKFFGD 155
            ::....|..|:|:|..||:||:..|||||:.||||||.||. .|:..||.|.:||||:.||..|.
 Worm    92 RMDASHRGVLLNRLADLMERDRVILASLESLDNGKPYKEAYNIDLPISIKTFRYYAGYADKNHGK 156

  Fly   156 TIPAGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAAL 219
            |||.|| :.:.||.|||||.|||||||:||||.|||..||||:|.|::||.|.:|||:|||:|:|
 Worm   157 TIPVGGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLAPALAMGNTVVMKVAVKTPLSALHVASL 221

  Fly   220 AKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGK 284
            .|||.||.||:|::.|.|..||.||::|.|:.|||||||.|:|:.:|:|||.||:|:|:||||||
 Worm   222 IKEAQFPEGVVNIIPGRGTDAGEAIASHMDVDKVAFTGSTEVGKTIMKAAAESNVKKVTLELGGK 286

  Fly   285 SPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQ 349
            ||.:||.|||::.||..:|.|||.|.||.|.|||||:|..||||||||||....:...:|:||::
 Worm   287 SPNIVFADADLEEAVRQSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIGDPFDE 351

  Fly   350 NVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFG 414
            |..||||||:..:..::.||||||||||:|..||.:.|:.|:||:||:|::|.|.|:||||||||
 Worm   352 NTTQGPQIDESQVETIMKYIESGKKEGAQLVTGGVKHGDQGYFVKPTIFANVNDQMKIAQEEIFG 416

  Fly   415 PVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGG 479
            ||..:.:|.|:||:|::|||..|||||||:|||:||||:.||.:.|||||:||||...|:.||||
 Worm   417 PVMIVIRFDSMEELIEKANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWVNCYDVFDPAAPFGG 481

  Fly   480 YKHSGIGRELGKDGLDNYLETKTITMKL 507
            :|.||||||||:.||..|.|.||:|:|:
 Worm   482 FKQSGIGRELGEYGLAAYTEVKTVTIKV 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 280/475 (59%)
alh-2NP_503467.2 ALDH_F1-2_Ald2-like 34..507 CDD:143410 279/473 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.