DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and alh-3

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_502054.2 Gene:alh-3 WormBaseID:WBGene00000109 Length:908 Species:Caenorhabditis elegans

Alignment Length:502 Identity:221/503 (44%)
Similarity:315/503 (63%) Gaps:19/503 (4%)


  Fly    13 LAVSRKWSKFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAV 77
            |.|:....||.|          ..||:.:||.|..|:||.|.||||.|.|.::.....||:|.||
 Worm   417 LNVNNMELKFPH----------DQFIDGKFVGSSDGRTFKTINPATEKPICELPLATVADVDRAV 471

  Fly    78 KAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILT 141
            :||||||.| .|||::|..:|...:.||..||:..|..||:||:.|.|..|..|| ..|..||..
 Worm   472 RAAKKAFER-GEWRQMSARERGKRLYKLAELMEEHKEELATLESLDAGAVYTLALKTHVGMSIDV 535

  Fly   142 LQYYAGWTDKFFGDTIPAGGF-----VSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTI 201
            .:|:|||.||..|.|||....     :.:|.:||:||||.|.||||||:||:||....||.|.|:
 Worm   536 WRYFAGWCDKIQGKTIPISNARPNKNLCLTLREPIGVVGLITPWNYPLMMLSWKMAACLAAGNTV 600

  Fly   202 IMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVM 266
            :.|||:.||||||..|.|:..||.|.||||:|.|.|...|..::||||:.|:.||||.|||..||
 Worm   601 VHKPAQVTPLTALKFAELSVLAGIPPGVINIVTGSGSLVGNRLTAHPDVRKIGFTGSTEIGATVM 665

  Fly   267 QAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFV 331
            ::.|.||:|:||||||||||:::|.|||::.||:....|:|.|.|::|.|..|.::.:.|:|:||
 Worm   666 ESCAKSNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVFIAKSIHDDFV 730

  Fly   332 AKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPT 396
            .|...:||..::|:|.:::...|||.....|.|::.|:|.....|||::.||||:...|.:..||
 Worm   731 KKLVEEAKQYQIGDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEVGGKRLEREGLYFPPT 795

  Fly   397 VFSDVKDDMRIAQEEIFGPVQSIFKF--SSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVD 459
            :.|::.|:...|.||.|||:..:..|  ..:|:::.|||:.::||||||.|.|.:|:|:.|..:.
 Worm   796 ILSNIDDENFAASEESFGPIMCVSSFDDDDIEDVLRRANDTEFGLAAGVFTRDSSKSLRVAEALH 860

  Fly   460 AGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMK 506
            ||:|::|.|.....:.||||:|.||.|:::|::.|:.||.|||||::
 Worm   861 AGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLVTKTITIE 907

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 216/481 (45%)
alh-3NP_502054.2 fmt 1..318 CDD:273088
FMT_core_FDH_N 1..209 CDD:187716
FDH_Hydrolase_C 214..315 CDD:187731
PP-binding 335..393 CDD:278949
ALDH-SF 423..908 CDD:299846 219/497 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.