DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh1a2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571925.1 Gene:aldh1a2 ZFINID:ZDB-GENE-011010-3 Length:518 Species:Danio rerio

Alignment Length:480 Identity:279/481 (58%)
Similarity:358/481 (74%) Gaps:2/481 (0%)


  Fly    30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLS 94
            |..|.::|||||:.||||||.|.|:||||.::|..|.|.||||:|.||:||:.||...|.|||:.
Zfish    34 EIKYTKIFINNEWHDSVSGKVFPTYNPATGEKICDVQEADKADVDKAVQAARSAFSLGSVWRKMD 98

  Fly    95 PLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALF-DVTYSILTLQYYAGWTDKFFGDTIP 158
            ..:|..|:.||..|::||.|:||:||:.|:|||:....| |:...|.|.:|||||.||..|.|||
Zfish    99 ASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYYAGWADKIHGSTIP 163

  Fly   159 AGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKE 222
            ..| |.::||.||:||.|||||||:||:|.|||.||||:.|.|:::|||||||||.|::.||.||
Zfish   164 IDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLKPAEQTPLTCLYLGALIKE 228

  Fly   223 AGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPV 287
            ||||.||:|::.|:|||||||||:|..|.|||||||.|:|:::.:||..||||||:||||||||.
Zfish   229 AGFPPGVVNILPGYGPTAGAAISSHMGIDKVAFTGSTEVGKLIQEAAGKSNLKRVTLELGGKSPN 293

  Fly   288 VVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQ 352
            ::|.|||.:.|:|..|:.:|.|:||.|.||||.:|.|.||||||.::..:|:.|||||||:...:
Zfish   294 IIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPFDPTTE 358

  Fly   353 QGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQ 417
            .|||:.::...:||..|:||..|||||:.|||.....||||||||||:|||.||||:||||||||
Zfish   359 HGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPATKGFFVEPTVFSNVKDHMRIAKEEIFGPVQ 423

  Fly   418 SIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKH 482
            .|.||.::||:|:||||.:|||||.|.|.||:||:..:..|.||:||||||:|:....||||:|.
Zfish   424 QIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINCYNAMSCQCPFGGFKM 488

  Fly   483 SGIGRELGKDGLDNYLETKTITMKL 507
            ||.|||||:.||..|.|.||||||:
Zfish   489 SGNGRELGEIGLKEYTELKTITMKM 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 277/475 (58%)
aldh1a2NP_571925.1 ALDH_F1AB_F2_RALDH1 32..512 CDD:143459 278/478 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99601561
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.