DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh2

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_033786.1 Gene:Aldh2 MGIID:99600 Length:519 Species:Mus musculus

Alignment Length:491 Identity:283/492 (58%)
Similarity:360/492 (73%) Gaps:8/492 (2%)


  Fly    25 TYAQCEPN-----YC-QLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKA 83
            |.|...||     :| |:|||||:.|:||.|||.|.||:|.:.|.||:||:|.|:|.|||||:.|
Mouse    24 TSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAA 88

  Fly    84 FHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYA-EALFDVTYSILTLQYYAG 147
            |...|.||::....|..|:.:|..|::||:.:||:|||.||||||. ..|.|:...:..|:||||
Mouse    89 FQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAG 153

  Fly   148 WTDKFFGDTIPA-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPL 211
            |.||:.|.|||. |.|.|.||.|||||.|||||||:||||.|||.|||||.|..::||.||||||
Mouse   154 WADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPL 218

  Fly   212 TALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKR 276
            |||::|.|.||||||.||:|:|.||||||||||::|..:.|||||||.|:|.::..||.:|||||
Mouse   219 TALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKR 283

  Fly   277 VSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKAR 341
            |:||||||||.::..|||:|:|||..|.|||.|.||.|||||||:|.|.:|||||.::.|:||:|
Mouse   284 VTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSR 348

  Fly   342 KVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMR 406
            .|||||:...:||||:|:....|:||||:||::|||||..||....:.|:|::||||.||||.|.
Mouse   349 VVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMT 413

  Fly   407 IAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAV 471
            ||:|||||||..|.||.::||::.|||:.:|||||.|.|.|::||...:..:.||:|||||||..
Mouse   414 IAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF 478

  Fly   472 LPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            ...:||||||.||.|||||:.||..|.|.||:|:|:
Mouse   479 GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 278/476 (58%)
Aldh2NP_033786.1 PLN02466 3..518 CDD:215259 283/492 (58%)
ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 278/480 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S334
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2025
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.