DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh1a1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001348432.1 Gene:Aldh1a1 MGIID:1353450 Length:501 Species:Mus musculus

Alignment Length:489 Identity:274/490 (56%)
Similarity:353/490 (72%) Gaps:11/490 (2%)


  Fly    21 KFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFH 85
            |..||         ::|||||:.:|||||.|...||||.:.|..|.||||||:|.|||||::||.
Mouse    17 KIQHT---------KIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQ 72

  Fly    86 RDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWT 149
            ..|.||.:...:|..|:|||..||:||:..||::|..:.||.:|.| |.|:...|..|:|.|||.
Mouse    73 IGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWA 137

  Fly   150 DKFFGDTIPAGGFV-SMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTA 213
            ||..|.|||:.|.: :.||:||:||.|||||||:|:||..||.||||:.|.|:::||||||||||
Mouse   138 DKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTA 202

  Fly   214 LHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVS 278
            ||:|:|.||||||.||:|:|.|:|||||||||:|.|:.|||||||.::|:::.:||..||||||:
Mouse   203 LHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVT 267

  Fly   279 LELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKV 343
            ||||||||.:||.|||:|.|||..|..:|.:.||.|.|.||.:|.|.:|||||.::..:||...:
Mouse   268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVL 332

  Fly   344 GNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIA 408
            |||....:.||||||.:...|:|..|||||||||||:.||.|.||.||||:|||||:|.|:||||
Mouse   333 GNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIA 397

  Fly   409 QEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLP 473
            :||||||||.|.||.|::::|.||||..||||||:.|.|::||:..::.:.||.||:|||..:..
Mouse   398 KEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSA 462

  Fly   474 STPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            ..||||:|.||.|||||:.||..|.|.||:.||:
Mouse   463 QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 270/475 (57%)
Aldh1a1NP_001348432.1 ALDH_F1AB_F2_RALDH1 15..495 CDD:143459 273/487 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2025
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.