DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and Aldh1l1

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001343341.1 Gene:Aldh1l1 MGIID:1340024 Length:902 Species:Mus musculus

Alignment Length:501 Identity:218/502 (43%)
Similarity:317/502 (63%) Gaps:22/502 (4%)


  Fly    27 AQCEPNYC-------------QLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVK 78
            ::|..||.             ||||..||||:...||::|.||.....|.|||....:|:|.||.
Mouse   402 SECVINYVEKAVKKLTLQMPYQLFIGGEFVDAEGAKTYSTINPTDGSVICQVSLAQVSDVDKAVA 466

  Fly    79 AAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILTL 142
            |||:|| .:..|.|::...|..|:.:|..||::.:..||::|..|.|..|..|| ..|..||.|.
Mouse   467 AAKEAF-ENGLWGKINARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTF 530

  Fly   143 QYYAGWTDKFFGDTIPAGGF-----VSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTII 202
            :|:|||.||..|.|||....     :::|:||||||.|.:|||||||:||:||....||.|.|::
Mouse   531 RYFAGWCDKIQGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVV 595

  Fly   203 MKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQ 267
            :|||:.||||||..|.|..:||.|.||:|::.|.|...|..:|.|||:.|:.||||.|:|:.:|:
Mouse   596 IKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK 660

  Fly   268 AAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVA 332
            :.|.||:|:||||||||||:::|.|.|::.||:....::|.|.|::|.|..|.:|.:.|:|:||.
Mouse   661 SCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDQFVQ 725

  Fly   333 KAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTV 397
            |...:....|:|||.:::...|||..:..|.|::.|.:.|.||||.|..||.::...|||.:|||
Mouse   726 KVVEEVGKMKIGNPLDRDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTV 790

  Fly   398 FSDVKDDMRIAQEEIFGPVQSIFKFS--SLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDA 460
            |:||:|.|.||:||.|||:..|.:|:  .::.::.|||..::|||:||.|.||||||..::.:.|
Mouse   791 FTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

  Fly   461 GSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMK 506
            |:|::|.|:....:.||||:|.||.|::||:..|:.||..||:|.:
Mouse   856 GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTFE 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 216/494 (44%)
Aldh1l1NP_001343341.1 FMT_core_FDH_N 1..203 CDD:187716
GART 1..203
Substrate binding. {ECO:0000250} 88..90
FDH_Hydrolase_C 206..306 CDD:187731
PP-binding 325..391 CDD:306928
ALDH_F1L_FTFDH 417..902 CDD:143458 215/487 (44%)
Aldehyde dehydrogenase 417..902 215/487 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99616791
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.