DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and wu:fb14d09

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_009296559.2 Gene:wu:fb14d09 ZFINID:ZDB-GENE-030131-8536 Length:516 Species:Danio rerio

Alignment Length:506 Identity:286/507 (56%)
Similarity:369/507 (73%) Gaps:20/507 (4%)


  Fly    22 FDHTYAQ------CE------PN------YCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEG 68
            |..|:.|      |:      ||      |.::|||||:.|:||.|||.|.||||.:.|..|:||
Zfish     6 FSRTFPQVFRISSCQHSTIPAPNVQPDVHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEG 70

  Fly    69 DKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL- 132
            ||||:|.|||||:.||...|.||::...||..|:::|...::||.|:||.|||.|||||||.:. 
Zfish    71 DKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFS 135

  Fly   133 FDVTYSILTLQYYAGWTDKFFGDTIPA-GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALA 196
            .||...:..::|||||.||:.|.|||. |.:...||.||:||.|||||||:||||.|||.|||||
Zfish   136 VDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALA 200

  Fly   197 VGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEI 261
            .|.|::||.|||||||||::|:|.||.||||||:|:|.||||||||||::|.|:.|||||||.::
Zfish   201 TGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIVPGFGPTAGAAIASHMDVDKVAFTGSTDV 265

  Fly   262 GRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKI 326
            |.::.:|::.||||:|:||||||||.::..||:::.|||.:|.|||.|.||.||||:||:|.|.|
Zfish   266 GHLIQRASSASNLKKVTLELGGKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESI 330

  Fly   327 YDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGF 391
            |||||.::..:||.|.||:||:.|.:||||:::|...||||||.|||:|||||..||......|:
Zfish   331 YDEFVERSVERAKNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGY 395

  Fly   392 FVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFAN 456
            |::||||.||||||.||:|||||||..|.||.||||:|:|||:.:||||..|.|.||:||...::
Zfish   396 FIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISH 460

  Fly   457 NVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            .:.||:||||||:......||||||.||||||:|:.||:||.|.||:|:|:
Zfish   461 GLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKV 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 279/475 (59%)
wu:fb14d09XP_009296559.2 ALDH_F1AB_F2_RALDH1 30..510 CDD:143459 279/480 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.