DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ro and Antp

Sequence 1:NP_524521.1 Gene:ro FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:310 Identity:87/311 (28%)
Similarity:121/311 (39%) Gaps:86/311 (28%)


  Fly     2 QRHKVEIGSPDGSPGIKRSDSLDPIANTTILSVP-------QRPS----------SPRQFFERLY 49
            |:|:| ...|| ||..:....:........|.||       |:||          :|:|..::| 
  Fly    78 QQHQV-YSRPD-SPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQL- 139

  Fly    50 GHLETRSSENGEIDVGTHAHKPPPCDTPYHS--------------DGGSVSSPDISISDERTSLA 100
                  .....::   ||..:.......|.|              :|||....|........:..
  Fly   140 ------PQVTQQV---THPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQM 195

  Fly   101 AYPAYDFYGHAKDYPQ-----------HPSQQHQQHHHHHHH-----------PPQ-LVHQKLSY 142
            ..|      |...:||           ..::.||.||:...:           ||| ::||.   
  Fly   196 TLP------HHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQG--- 251

  Fly   143 VSPPPAIAAG--GAANPVL--PHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQT 203
             ..||.:..|  |...|..  |::..:|.|| |.:....|.|...:.||.|||     |::..||
  Fly   252 -QGPPQMHQGHPGQHTPPSQNPNSQSSGMPS-PLYPWMRSQFGKCQERKRGRQ-----TYTRYQT 309

  Fly   204 LRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253
            |.||.|||.|.|::|.||.|:|..|.|||.||||||||||.|.|:..|.:
  Fly   310 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/51 (61%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.