DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and test-1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001023098.1 Gene:test-1 / 177010 WormBaseID:WBGene00016918 Length:226 Species:Caenorhabditis elegans


Alignment Length:146 Identity:36/146 - (24%)
Similarity:58/146 - (39%) Gaps:24/146 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 HEPRSCEGEDLKDFPRRMRDWLFNVMRDLAERDELTEHYMQME---LEAETNNSRRWSNAAVWKW 227
            ||...|...:|.....|:..|    .:|:..::...:|.:::.   ...|..          |.:
 Worm    35 HEKNHCTRSELMRMGGRLVKW----FKDVHAQESGADHTLKLHSVPCRVEVG----------WMF 85

  Fly   228 CDLDGDTDRSVSRHELFPIRAPLVSLEHCIAPFLESCDSN-KDHRITLVEWGACLELDPEDLKER 291
            ...||:.|..:|:.||.||...  ..|.|:..|::.||.. .|..|::.||..|.... :||:..
 Worm    86 NQWDGNQDGKLSKAELRPIERG--GNEACVEEFIDMCDDMVVDGSISVDEWCDCFTFS-DDLRHE 147

  Fly   292 --CDDVQR-AQPHLLG 304
              |...:. ..|||||
 Worm   148 PPCHKAKHDVDPHLLG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 1/1 (100%)
SPARC_Ca_bdg 169..278 CDD:287550 24/112 (21%)
SPARC_EC 170..292 CDD:238155 28/127 (22%)
test-1NP_001023098.1 EFh_SPARC_TICN 40..142 CDD:320011 26/118 (22%)
EF-hand motif 77..108 CDD:320011 10/42 (24%)
EF-hand motif 109..140 CDD:320011 10/30 (33%)
TY 149..207 CDD:238114 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.