DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and HTA13

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_188703.1 Gene:HTA13 / 821614 AraportID:AT3G20670 Length:132 Species:Arabidopsis thaliana


Alignment Length:123 Identity:75/123 - (60%)
Similarity:89/123 - (72%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
            |||......||.|| |:.|||::||||||||||.|.||:...: .||||.|.||.||:||||.||
plant     1 MAGRGKTLGSGVAK-KSTSRSSKAGLQFPVGRIARFLKNGKYA-TRVGAGAPVYLAAVLEYLAAE 63

  Fly    66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 122
            ||||||||::|.|..||.|||:|||:|.||||..|: ..|||.|||:|:||..|:.||
plant    64 VLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHSLLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 70/115 (61%)
HTA13NP_188703.1 PLN00157 1..132 CDD:177758 75/123 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.