DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and his-19

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_505296.1 Gene:his-19 / 259800 WormBaseID:WBGene00001893 Length:127 Species:Caenorhabditis elegans


Alignment Length:124 Identity:76/124 - (61%)
Similarity:90/124 - (72%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG-GKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTA 64
            |:| ||.||  .|...||.|||:||||||||||:||.|:....:. ||||.|.||.||:||||.|
 Worm     1 MSGRGKGGK--AKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQ-RVGAGAPVYLAAVLEYLAA 62

  Fly    65 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
            |||||||||::|.|..||.|||||||:|.||||:.|:. .|||.|||:|:|...|:.||
 Worm    63 EVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 70/115 (61%)
his-19NP_505296.1 PTZ00017 18..127 CDD:185399 67/105 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.