DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2Av and H2al1g

DIOPT Version :9

Sequence 1:NP_001262997.1 Gene:His2Av / 43229 FlyBaseID:FBgn0001197 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001229881.1 Gene:H2al1g / 100042943 MGIID:3710577 Length:105 Species:Mus musculus


Alignment Length:84 Identity:29/84 - (34%)
Similarity:49/84 - (58%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRIT 83
            :||.|..|.|.:  :.|.|:....| .|:.::|..:..::|||||:.:|||||..::....|||.
Mouse    14 TRSQRGELPFSL--VDRFLREEFHS-SRLSSSALSFLTSVLEYLTSNILELAGEVAQTTGRKRIA 75

  Fly    84 PRHLQLAIRGDEELDSLIK 102
            |..::|.::.:|:|..|.|
Mouse    76 PEDVRLVVQNNEQLRQLFK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2AvNP_001262997.1 PLN00154 6..121 CDD:177756 29/84 (35%)
H2al1gNP_001229881.1 H2A <50..>94 CDD:330514 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.