DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and RLP35

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001319521.1 Gene:RLP35 AraportID:AT3G11080 Length:943 Species:Arabidopsis thaliana

Alignment Length:1102 Identity:232/1103 (21%)
Similarity:388/1103 (35%) Gaps:376/1103 (34%)


  Fly    31 RDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFR--LTIQPKDYVQIMCNLTDTTDYQQLPKK 93
            |..|.....|.|.:   :.:|:||..| ::.:..:|  ..:.|....:...|.:|..:::.:...
plant    35 RHLCLPEQRDALLE---LKNEFEIGKP-SSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCD 95

  Fly    94 LRIGEVDRVQMRRCMLPG--HTPIASILDYLGIVSPTTLIFESDNLG-MNITRQHLDRLHGLKRF 155
            .:.|||..:.:....|.|  |:              .:.:|...||. :::|:..||        
plant    96 TKSGEVIELDLSCSWLYGSFHS--------------NSSLFRLQNLRVLDLTQNDLD-------- 138

  Fly   156 RFTTRRLTHIPANLLTDMRNLSHL-ELRANIEE----MPSHLFDDLENLESIEFGSNKLR-QMPR 214
                   ..||:::    .||||| .|..:..:    :||.: ::|..|.|:...||:.. |:|.
plant   139 -------GEIPSSI----GNLSHLTSLHLSYNQFLGLIPSSI-ENLSRLTSLHLSSNQFSGQIPS 191

  Fly   215 GIFGKMPKLKQLNLWSNQ-----------LHNLT-----KHDFEG-ATSVLG--------IDIHD 254
            .| |.:..|..|.|.|||           |.|||     .:||.| ..|.:|        ...::
plant   192 SI-GNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYN 255

  Fly   255 NGIEQLPHDVFAHLTNVTDINLSAN-LFRSLPQGLFD----------HNKHL----NEVRLMNNR 304
            |.:.::|.. |.:|..:..:.:.:| |..::|..|.:          ||:..    |.:.|::|.
plant   256 NFVGEIPSS-FGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNL 319

  Fly   305 VPL--------ATLPSRLFANQPELQILRLRAELQSLPGDL-FEHSTQITNISL----GDNLLKT 356
            :..        .||||.|| |.|.|  :||......|.|.| |.:.:..:|:..    .:|.:.|
plant   320 MDFEASNNAFTGTLPSSLF-NIPPL--IRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGT 381

  Fly   357 LPATLLEHQVNLLSLDLS--NNRLTHLPDSLFAHTTNLTDLRLEDNLLTGIS-GDIFSNLGNLVT 418
            :|.: |...|||...|||  |.:...:..|:|:|..:|.||||.....|.|. .||......|.:
plant   382 IPRS-LSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRS 445

  Fly   419 LVMSRNRLRTIDSRAFVSTN----GLRHLHLDHNDI-DLQQPLLDIMLQTQINSPFGYMHGLLTL 478
            |.:|.| |.:..:::.||::    .::.|:|....| |..:     :|:||        |.|..|
plant   446 LDISGN-LVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPE-----ILRTQ--------HELGFL 496

  Fly   479 NLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDV 543
            ::.||.|......|..|:..|..|:||.|..       ::|.|.::.|      .:..:..|..:
plant   497 DVSNNKIKGQVPGWLWTLPNLFYLNLSNNTF-------ISFESSSKKH------GLSSVRKPSMI 548

  Fly   544 HLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPV 608
            ||....||                                    |..:....:|.         :
plant   549 HLFASNNN------------------------------------FTGKIPSFICG---------L 568

  Fly   609 RQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMEL 673
            |.:.      .||.|::......||   |..:......|:|....||:  ..||.          
plant   569 RSLN------TLDLSENNYNGSIPR---CMEKLKSTLFVLNLRQNNLS--GGLPK---------- 612

  Fly   674 HLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLN 738
            |:               :||:.||.: |:||.   |.:||.:|    |.:::|::||.. ...:|
plant   613 HI---------------FESLRSLDV-GHNLL---VGKLPRSL----IRFSNLEVLNVE-SNRIN 653

  Fly   739 RTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFE-----------RIGD--RNEMMCVNAEMPTR- 789
            .|..:         |:...:...:|:...:.|.           ||.|  .|..   |..:||. 
plant   654 DTFPF---------WLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHF---NGTLPTEY 706

  Fly   790 ------MVELSTNDICPAEK----GVFIALAVVIALTGL-------LAGFTAALY--YKFQTEIK 835
                  |..|..|:....||    |::...::|:...||       |..:||..:  .||:.||.
plant   707 FVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIP 771

  Fly   836 IWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVG 900
                                            |....:::.||..|.:.             ..|
plant   772 --------------------------------KSIGLLKELLVLNLSNN-------------AFG 791

  Fly   901 GHIPENIMRSVA-DSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKL 964
            ||||.::....| :|    :.:|||.:..|                        |..::||:..|
plant   792 GHIPSSMGNLTALES----LDVSQNKLTGE------------------------IPQELGDLSFL 828

  Fly   965 DEELKAYLKMNTYLKWGDPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKLELIKPS 1026
                 ||:..:                   |.:..|.:..|...:.....:.::.|.|..||
plant   829 -----AYMNFS-------------------HNQLAGLVPGGTQFRRQNCSAFENNLGLFGPS 866

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 23/76 (30%)
leucine-rich repeat 176..198 CDD:275380 8/27 (30%)
leucine-rich repeat 199..222 CDD:275380 8/24 (33%)
LRR_RI 216..542 CDD:238064 100/387 (26%)
LRR_8 221..281 CDD:290566 21/86 (24%)
leucine-rich repeat 223..270 CDD:275380 19/72 (26%)
leucine-rich repeat 271..294 CDD:275380 6/34 (18%)
leucine-rich repeat 295..320 CDD:275380 11/37 (30%)
leucine-rich repeat 321..343 CDD:275380 7/23 (30%)
LRR_8 342..402 CDD:290566 20/66 (30%)
leucine-rich repeat 344..367 CDD:275380 6/27 (22%)
leucine-rich repeat 368..391 CDD:275380 8/25 (32%)
LRR_8 390..450 CDD:290566 18/65 (28%)
leucine-rich repeat 392..415 CDD:275380 9/24 (38%)
leucine-rich repeat 416..439 CDD:275380 7/27 (26%)
leucine-rich repeat 440..474 CDD:275380 8/35 (23%)
leucine-rich repeat 475..498 CDD:275380 7/23 (30%)
LRR_8 477..534 CDD:290566 14/57 (25%)
leucine-rich repeat 499..520 CDD:275380 6/21 (29%)
leucine-rich repeat 523..552 CDD:275380 6/29 (21%)
LRRCT 561..619 CDD:214507 3/58 (5%)
LRRNT 631..667 CDD:214470 9/36 (25%)
leucine-rich repeat 664..693 CDD:275380 2/29 (7%)
LRR_8 669..726 CDD:290566 13/57 (23%)
leucine-rich repeat 694..715 CDD:275380 8/21 (38%)
leucine-rich repeat 716..737 CDD:275380 5/21 (24%)
LRRCT 751..800 CDD:214507 13/69 (19%)
TIR 858..996 CDD:214587 22/139 (16%)
RLP35NP_001319521.1 LRRNT_2 39..95 CDD:311940 10/60 (17%)
PLN00113 79..>658 CDD:331614 168/736 (23%)
leucine-rich repeat 103..123 CDD:275380 4/34 (12%)
leucine-rich repeat 127..150 CDD:275380 9/42 (21%)
leucine-rich repeat 151..174 CDD:275380 5/24 (21%)
leucine-rich repeat 175..198 CDD:275380 8/24 (33%)
leucine-rich repeat 199..222 CDD:275380 7/23 (30%)
leucine-rich repeat 223..246 CDD:275380 7/23 (30%)
leucine-rich repeat 247..270 CDD:275380 4/24 (17%)
leucine-rich repeat 271..294 CDD:275380 4/23 (17%)
leucine-rich repeat 295..318 CDD:275380 4/23 (17%)
leucine-rich repeat 319..337 CDD:275380 4/18 (22%)
leucine-rich repeat 343..367 CDD:275380 7/26 (27%)
leucine-rich repeat 368..388 CDD:275380 4/21 (19%)
leucine-rich repeat 392..417 CDD:275380 8/25 (32%)
leucine-rich repeat 443..469 CDD:275380 7/27 (26%)
leucine-rich repeat 470..492 CDD:275380 8/35 (23%)
leucine-rich repeat 493..516 CDD:275380 7/23 (30%)
leucine-rich repeat 517..541 CDD:275380 8/37 (22%)
leucine-rich repeat 542..570 CDD:275380 8/73 (11%)
leucine-rich repeat 571..594 CDD:275380 6/32 (19%)
leucine-rich repeat 596..617 CDD:275380 8/48 (17%)
leucine-rich repeat 618..641 CDD:275380 10/31 (32%)
LRR_8 640..698 CDD:316378 12/68 (18%)
leucine-rich repeat 642..665 CDD:275380 6/33 (18%)
leucine-rich repeat 716..803 CDD:275380 24/132 (18%)
PLN00113 <758..864 CDD:331614 31/203 (15%)
leucine-rich repeat 804..825 CDD:275380 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.