DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and LRRC3

DIOPT Version :10

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_112153.1 Gene:LRRC3 / 81543 HGNCID:14965 Length:257 Species:Homo sapiens


Alignment Length:269 Identity:63/269 - (23%)
Similarity:105/269 - (39%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 FVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQIN-------SPFGYMHGLLTLNLRNNSIIFVYND 491
            |.|..||:.:   ..||    |...::|:...|       ..|.::|                  
Human    49 FCSLRGLQEV---PEDI----PANTVLLKLDANKISHLPDGAFQHLH------------------ 88

  Fly   492 WKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHV 556
                  :|||||||:|.|.::|....|.|:.....:::::|:|:||  |:|. ||:    ....:
Human    89 ------RLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRI--PKDA-LGK----LSAKI 140

  Fly   557 DLNDNPLVCDCTI---LWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLIC 618
            .|:.|||.|:|.:   ||.::|     .|.       ..|.:.|.       |.|::        
Human   141 RLSHNPLHCECALQEALWELKL-----DPD-------SVDEIACH-------TSVQE-------- 178

  Fly   619 PLDFSDDPRERKCPRG---CNCHVRTYDKALVINC---HSGNLTHVPRLPNLHKNMQLMELHLEN 677
              :|...|..:....|   |:...||.|.|:::..   .:..:.:|  :..:..|.:....||| 
Human   179 --EFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYV--VYYVRHNQEDARRHLE- 238

  Fly   678 NTLLRLPSA 686
             .|..||||
Human   239 -YLKSLPSA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:404697
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR 222..576 CDD:443914 39/151 (26%)
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 368..391 CDD:275380
leucine-rich repeat 392..415 CDD:275380
leucine-rich repeat 416..439 CDD:275380 2/4 (50%)
leucine-rich repeat 440..474 CDD:275380 7/40 (18%)
leucine-rich repeat 475..498 CDD:275380 0/22 (0%)
leucine-rich repeat 499..520 CDD:275380 11/20 (55%)
leucine-rich repeat 523..552 CDD:275380 8/28 (29%)
LRRCT 561..619 CDD:214507 13/60 (22%)
LRRNT 631..667 CDD:214470 7/41 (17%)
PPP1R42 <660..752 CDD:455733 9/27 (33%)
leucine-rich repeat 664..693 CDD:275380 9/23 (39%)
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
LRRC3NP_112153.1 LRRNT 32..68 CDD:214470 7/25 (28%)
leucine-rich repeat 48..65 CDD:275378 7/22 (32%)
LRR 1 65..86 3/20 (15%)
leucine-rich repeat 66..89 CDD:275378 4/46 (9%)
LRR_8 69..125 CDD:404697 17/79 (22%)
LRR 2 89..110 10/20 (50%)
leucine-rich repeat 90..114 CDD:275378 12/23 (52%)
LRR 3 114..135 7/23 (30%)
leucine-rich repeat 115..138 CDD:275378 8/29 (28%)
LRR 4 136..157 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.