DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and LRRC3

DIOPT Version :9

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_112153.1 Gene:LRRC3 / 81543 HGNCID:14965 Length:257 Species:Homo sapiens


Alignment Length:269 Identity:63/269 - (23%)
Similarity:105/269 - (39%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 FVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQIN-------SPFGYMHGLLTLNLRNNSIIFVYND 491
            |.|..||:.:   ..||    |...::|:...|       ..|.::|                  
Human    49 FCSLRGLQEV---PEDI----PANTVLLKLDANKISHLPDGAFQHLH------------------ 88

  Fly   492 WKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHV 556
                  :|||||||:|.|.::|....|.|:.....:::::|:|:||  |:|. ||:    ....:
Human    89 ------RLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRI--PKDA-LGK----LSAKI 140

  Fly   557 DLNDNPLVCDCTI---LWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLIC 618
            .|:.|||.|:|.:   ||.::|     .|.       ..|.:.|.       |.|::        
Human   141 RLSHNPLHCECALQEALWELKL-----DPD-------SVDEIACH-------TSVQE-------- 178

  Fly   619 PLDFSDDPRERKCPRG---CNCHVRTYDKALVINC---HSGNLTHVPRLPNLHKNMQLMELHLEN 677
              :|...|..:....|   |:...||.|.|:::..   .:..:.:|  :..:..|.:....||| 
Human   179 --EFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYV--VYYVRHNQEDARRHLE- 238

  Fly   678 NTLLRLPSA 686
             .|..||||
Human   239 -YLKSLPSA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 28/114 (25%)
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
LRR_8 342..402 CDD:290566
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 368..391 CDD:275380
LRR_8 390..450 CDD:290566 4/15 (27%)
leucine-rich repeat 392..415 CDD:275380
leucine-rich repeat 416..439 CDD:275380 2/4 (50%)
leucine-rich repeat 440..474 CDD:275380 7/40 (18%)
leucine-rich repeat 475..498 CDD:275380 0/22 (0%)
LRR_8 477..534 CDD:290566 13/56 (23%)
leucine-rich repeat 499..520 CDD:275380 11/20 (55%)
leucine-rich repeat 523..552 CDD:275380 8/28 (29%)
LRRCT 561..619 CDD:214507 13/60 (22%)
LRRNT 631..667 CDD:214470 7/41 (17%)
leucine-rich repeat 664..693 CDD:275380 9/23 (39%)
LRR_8 669..726 CDD:290566 8/18 (44%)
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
LRRC3NP_112153.1 LRRNT 32..68 CDD:214470 7/25 (28%)
leucine-rich repeat 48..65 CDD:275378 7/22 (32%)
LRR 1 65..86 3/20 (15%)
leucine-rich repeat 66..89 CDD:275378 4/46 (9%)
LRR_8 69..125 CDD:290566 17/79 (22%)
LRR_4 69..103 CDD:289563 13/57 (23%)
LRR_4 89..129 CDD:289563 16/41 (39%)
LRR 2 89..110 10/20 (50%)
leucine-rich repeat 90..114 CDD:275378 12/23 (52%)
LRR 3 114..135 7/23 (30%)
leucine-rich repeat 115..138 CDD:275378 8/29 (28%)
LRR 4 136..157 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.