DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr4al

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001315534.1 Gene:tlr4al ZFINID:ZDB-GENE-090507-2 Length:816 Species:Danio rerio

Alignment Length:956 Identity:209/957 (22%)
Similarity:362/957 (38%) Gaps:313/957 (33%)


  Fly   174 RNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTK 238
            ||||::..|     :||       ::::::|..|.|:.:.:.:|.....|:.|:|  ::.|    
Zfish    35 RNLSYIPSR-----IPS-------SVQTLDFSFNDLKWLKKTVFPVFTFLRVLDL--SRCH---- 81

  Fly   239 HDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNN 303
                              |.|:.:|.|.::.|:|.:.|:.|.......|..  |...|..||:..
Zfish    82 ------------------IRQIENDAFYNVKNLTTLFLTGNPIIYFAPGCL--NTLYNLQRLVLV 126

  Fly   304 RVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLK--TLP---ATLLE 363
            .:.|.:|         :|.|..|               |::..:::|.|.::  |||   :|..:
Zfish   127 DIGLESL---------QLNINNL---------------TKLQELNVGTNYIQSMTLPPFMSTFKD 167

  Fly   364 HQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRT 428
            ..:    |||              |..|::.:|....:       :...:|..:||::|||.|..
Zfish   168 FSL----LDL--------------HANNISIIRTNHTV-------VLREIGKNMTLILSRNPLLH 207

  Fly   429 IDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQ-------IN-----------------SPF 469
            |:..:|      :.:||  .::|::...:....:.|       :|                 |..
Zfish   208 IEPGSF------KGVHL--VELDIRSTFVSFASKKQGLNGLHGLNVTRLMFGMYKDDPKLYPSDL 264

  Fly   470 GYMHGLLTLNLRNNSIIFVYN----DWK----NTMLQLRELDLSYNNISSLGY------EDLAFL 520
            .|..||.:::...   .:.|.    |||    ..|:....:.:....|..:||      ::| :|
Zfish   265 DYFDGLCSIHFYE---AYYYMKERLDWKMNIFRCMINATVVVVKGGVIRVIGYVPFHKIKEL-YL 325

  Fly   521 SQNRL---------HVN------MTHNKIRRIA----LPEDVHLGEGYNNNLVHVDLNDNPLVC- 565
            ...:|         |:.      .|||...::.    :|:           |.:||||.|.:.. 
Zfish   326 INTQLYTVPGKQLSHIRTLEKFVFTHNSATQVEKFLDMPK-----------LQYVDLNSNQITLQ 379

  Fly   566 DCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERK 630
            .|.    |.::.|.  ||. |...|..:..:.......||....:|        |||.       
Zfish   380 SCC----IDVLSGT--PQI-RYLNLSLNPQISLDKGGFEGLESLEI--------LDFH------- 422

  Fly   631 CPRGCNCHVR---------------------TYDKALVIN--CHSG------------------- 653
                   |.:                     :|.....:|  |..|                   
Zfish   423 -------HTKLLGIGSFTLLSNLKNLRYLDISYSSVTFVNVYCFYGLSSLKVLKMAGNSFQGDVA 480

  Fly   654 -----NLTHVPRLP-------NLH----KNMQ-LMELHLENNTLLRLPSANTPGYESVTSLHLAG 701
                 |||.:..|.       .:|    ||:| |..|:|..|.|:.:.....|..:.:|:.::..
Zfish   481 NYLFNNLTFLEHLDISYCHVIEIHLTSFKNLQRLRHLNLRGNNLMSIDFLTDPNLKQLTTFYVNK 545

  Fly   702 NNLTSIDVD---QLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLL 763
            |::|:|.:|   :||.||:..|:|:                           ||..|.|:....:
Zfish   546 NSITTIPLDILQKLPMNLSEFDLSF---------------------------NPIDCSCSQTDFM 583

  Fly   764 LFTQDNFERIGDRNEMMC--VNAEMPTRMVELSTNDICPAEKGVFIALAV--VIALTGLLAGFTA 824
            |:..:|...:.....::|  ::.....|:.:... |.|..:|.:.|||.|  |:.:..|     :
Zfish   584 LWIINNQRVLKQPENILCKTISPNSDFRVTDFDI-DHCVYKKKLIIALLVFCVVFIVVL-----S 642

  Fly   825 ALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQ 889
            .|.|:||..::   |...||..:  .....::..:|||:.:|..|::::.:.|:..||:|....|
Zfish   643 ILVYRFQFYLR---YCWILLRGY--RSPGQQECSYDAFVIFSSYDEAWVMNELMENLENGVPPIQ 702

  Fly   890 LCVHERDWLVGGHIPENIM-RSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVI 953
            ||:|.||:..|..|..||: ..:..||:.|:|:||:||.|.|.|.||..|....:.|..:.||:|
Zfish   703 LCLHMRDFQAGKSIASNIIDEGIMGSRKIIVVVSQHFIDSAWCRFEFELAQSRFVVERNANIIII 767

  Fly   954 IYSDIGDVE-KLDEELKAYLKMNTYLKWG-DPW----FWDKLRFAL 993
            |..|:.:.: |....|..:||.||||||. ||.    ||.:||.|:
Zfish   768 ILEDVAERKTKKVLGLHKHLKKNTYLKWSRDPLSNMRFWIRLRKAI 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 14/59 (24%)
leucine-rich repeat 176..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 70/388 (18%)
LRR_8 221..281 CDD:290566 12/60 (20%)
leucine-rich repeat 223..270 CDD:275380 8/47 (17%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 5/25 (20%)
leucine-rich repeat 321..343 CDD:275380 4/22 (18%)
LRR_8 342..402 CDD:290566 13/65 (20%)
leucine-rich repeat 344..367 CDD:275380 6/28 (21%)
leucine-rich repeat 368..391 CDD:275380 4/23 (17%)
LRR_8 390..450 CDD:290566 13/60 (22%)
leucine-rich repeat 392..415 CDD:275380 2/23 (9%)
leucine-rich repeat 416..439 CDD:275380 8/23 (35%)
leucine-rich repeat 440..474 CDD:275380 7/58 (12%)
leucine-rich repeat 475..498 CDD:275380 6/31 (19%)
LRR_8 477..534 CDD:290566 15/86 (17%)
leucine-rich repeat 499..520 CDD:275380 4/27 (15%)
leucine-rich repeat 523..552 CDD:275380 6/48 (13%)
LRRCT 561..619 CDD:214507 11/59 (19%)
LRRNT 631..667 CDD:214470 11/94 (12%)
leucine-rich repeat 664..693 CDD:275380 10/34 (29%)
LRR_8 669..726 CDD:290566 18/61 (30%)
leucine-rich repeat 694..715 CDD:275380 7/24 (29%)
leucine-rich repeat 716..737 CDD:275380 3/21 (14%)
LRRCT 751..800 CDD:214507 10/51 (20%)
TIR 858..996 CDD:214587 56/144 (39%)
tlr4alNP_001315534.1 leucine-rich repeat 28..47 CDD:275380 7/24 (29%)
leucine-rich repeat 48..71 CDD:275380 4/23 (17%)
LRR_8 72..127 CDD:290566 17/81 (21%)
leucine-rich repeat 72..95 CDD:275380 8/47 (17%)
leucine-rich repeat 96..119 CDD:275380 5/25 (20%)
leucine-rich repeat 120..142 CDD:275380 8/46 (17%)
leucine-rich repeat 143..168 CDD:275380 6/25 (24%)
leucine-rich repeat 170..196 CDD:275380 7/51 (14%)
leucine-rich repeat 321..343 CDD:275380 4/23 (17%)
LRR_RI 364..>524 CDD:238064 37/200 (19%)
LRR_8 364..426 CDD:290566 21/102 (21%)
leucine-rich repeat 366..391 CDD:275380 10/31 (32%)
leucine-rich repeat 392..415 CDD:275380 4/24 (17%)
LRR_8 415..475 CDD:290566 9/82 (11%)
leucine-rich repeat 416..440 CDD:275380 5/46 (11%)
leucine-rich repeat 441..464 CDD:275380 4/23 (17%)
leucine-rich repeat 465..489 CDD:275380 3/24 (13%)
leucine-rich repeat 490..513 CDD:275380 5/23 (22%)
LRR_4 512..552 CDD:289563 11/40 (28%)
LRR_8 513..573 CDD:290566 19/87 (22%)
leucine-rich repeat 514..537 CDD:275380 6/23 (26%)
leucine-rich repeat 538..562 CDD:275380 7/24 (29%)
TIR 672..813 CDD:214587 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.