DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and TLR3

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_003256.1 Gene:TLR3 HGNCID:11849 Length:904 Species:Homo sapiens

Alignment Length:1004 Identity:227/1005 (23%)
Similarity:405/1005 (40%) Gaps:235/1005 (23%)


  Fly   121 YLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMR--NLSHLELRA 183
            :.|.:.|..::..|......::.:..|..|         .:||.:|.:|.|::.  ||:|.:|| 
Human    10 FWGGLLPFGMLCASSTTKCTVSHEVADCSH---------LKLTQVPDDLPTNITVLNLTHNQLR- 64

  Fly   184 NIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVL 248
               .:|:..|.....|.|::.|.|.:.::...:..|:|.||.|||..|:|..|:...|...|::.
Human    65 ---RLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLT 126

  Fly   249 GIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRV-PLATLPS 312
            .:.:..|.|:::.::.|....|:..::||.|...|...|.....::|.|:.|.||:: .|.:...
Human   127 ELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEEL 191

  Fly   313 RLFANQPELQILRLRAE--LQSLPG---------DLFEHSTQITNISLGDNLLKTLPATLLEHQV 366
            .:|||. .|:.|.|.:.  .:..||         .||     :.|:.||.:|.:.|...|.  ..
Human   192 DIFANS-SLKKLELSSNQIKEFSPGCFHAIGRLFGLF-----LNNVQLGPSLTEKLCLELA--NT 248

  Fly   367 NLLSLDLSNNRLTHLPDSLF--AHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTI 429
            ::.:|.|||::|:...::.|  ...||||.|.|..|.|..:..|.|:.|..|....:..|.::.:
Human   249 SIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHL 313

  Fly   430 DSRAFVSTNGLRHLHLDHN----DIDLQQ-PLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVY 489
            .|.:......:|:|:|..:    .|.|.. |.:|       :..|.::..|..||:.:|.|..:.
Human   314 FSHSLHGLFNVRYLNLKRSFTKQSISLASLPKID-------DFSFQWLKCLEHLNMEDNDIPGIK 371

  Fly   490 NDWKNTMLQLRELDL--SYNNISSLGYEDLAFLSQNRLHV-NMTHNKIRRIALPEDVHLGE---- 547
            ::....::.|:.|.|  |:.::.:|..|....|:.:.||: |:|.|||.:|.......||.    
Human   372 SNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVL 436

  Fly   548 --GYN--------------NNLVHVDLNDNPLVCDCTILWFIQLVRGVHK--PQYSRQFKLRTDR 594
              |.|              .|:..:.|:.|.         ::||.|....  |...| ..||...
Human   437 DLGLNEIGQELTGQEWRGLENIFEIYLSYNK---------YLQLTRNSFALVPSLQR-LMLRRVA 491

  Fly   595 L--VCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTH 657
            |  |.|.|:..:  |:|.:   |:   ||.|::                                
Human   492 LKNVDSSPSPFQ--PLRNL---TI---LDLSNN-------------------------------- 516

  Fly   658 VPRLPNLHKNM-----QLMELHLENNTLLRLPSANTPG-----YESVTSLHLAGNNLTSIDVDQL 712
              .:.|::.:|     :|..|.|::|.|.||.....||     .:.::.||:.  ||.|...|::
Human   517 --NIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHIL--NLESNGFDEI 577

  Fly   713 PT-------NLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSG-------------------- 750
            |.       .|..:|:..|:|..|.|:|   .|..:..:|:.|..                    
Human   578 PVEVFKDLFELKIIDLGLNNLNTLPASV---FNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTE 639

  Fly   751 -----NPWMCDCTAKPLLLF------TQDNFERIGDRNEMMCVNAE----MPTRMVELST-NDIC 799
                 ||:  |||.:.:..|      |..|...:.  :..:|....    .|.|:.:.|: .|..
Human   640 LDMRFNPF--DCTCESIAWFVNWINETHTNIPELS--SHYLCNTPPHYHGFPVRLFDTSSCKDSA 700

  Fly   800 PAEKG---------VFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDK 855
            |.|..         :||.:.::|...|....|             .|..:.:.:|.|   :::|:
Human   701 PFELFFMINTSILLIFIFIVLLIHFEGWRISF-------------YWNVSVHRVLGF---KEIDR 749

  Fly   856 DK---KFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRT 917
            ..   ::.|:|.:::||:.::.::. ..:|...|..:.|:.|||:..|....|.|:.|:..||:.
Human   750 QTEQFEYAAYIIHAYKDKDWVWEHF-SSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKI 813

  Fly   918 IIVLSQNFIKSEWARLEFRAAH--RSALNEGRSRIIVIIYSDIGDVEKLDEEL---KAYLKMNTY 977
            |.|::.:.:|....: .|:..|  :.|:.:....||::...:|.|. ||:..|   :...|.:..
Human   814 IFVITHHLLKDPLCK-RFKVHHAVQQAIEQNLDSIILVFLEEIPDY-KLNHALCLRRGMFKSHCI 876

  Fly   978 LKWGDP-------WFWDKLRFALPHRRPV 999
            |.|  |       .|..||:.||..:..|
Human   877 LNW--PVQKERIGAFRHKLQVALGSKNSV 903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 19/61 (31%)
leucine-rich repeat 176..198 CDD:275380 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 6/23 (26%)
LRR_RI 216..542 CDD:238064 91/348 (26%)
LRR_8 221..281 CDD:290566 18/60 (30%)
leucine-rich repeat 223..270 CDD:275380 13/47 (28%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 9/26 (35%)
leucine-rich repeat 321..343 CDD:275380 7/33 (21%)
LRR_8 342..402 CDD:290566 19/62 (31%)
leucine-rich repeat 344..367 CDD:275380 6/23 (26%)
leucine-rich repeat 368..391 CDD:275380 7/25 (28%)
LRR_8 390..450 CDD:290566 17/64 (27%)
leucine-rich repeat 392..415 CDD:275380 9/23 (39%)
leucine-rich repeat 416..439 CDD:275380 3/23 (13%)
leucine-rich repeat 440..474 CDD:275380 8/39 (21%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 17/60 (28%)
leucine-rich repeat 499..520 CDD:275380 6/23 (26%)
leucine-rich repeat 523..552 CDD:275380 12/50 (24%)
LRRCT 561..619 CDD:214507 15/62 (24%)
LRRNT 631..667 CDD:214470 1/36 (3%)
leucine-rich repeat 664..693 CDD:275380 10/39 (26%)
LRR_8 669..726 CDD:290566 19/69 (28%)
leucine-rich repeat 694..715 CDD:275380 7/28 (25%)
leucine-rich repeat 716..737 CDD:275380 7/21 (33%)
LRRCT 751..800 CDD:214507 13/60 (22%)
TIR 858..996 CDD:214587 38/150 (25%)
TLR3NP_003256.1 leucine-rich repeat 33..52 CDD:275380 7/28 (25%)
LRR 1 52..73 7/25 (28%)
leucine-rich repeat 53..76 CDD:275380 7/27 (26%)
PLN00113 72..>542 CDD:331614 125/537 (23%)
LRR 2 76..97 4/21 (19%)
leucine-rich repeat 77..100 CDD:275380 6/23 (26%)
LRR 3 100..121 9/21 (43%)
leucine-rich repeat 101..124 CDD:275380 10/23 (43%)
LRR 4 124..145 3/21 (14%)
leucine-rich repeat 125..148 CDD:275380 3/23 (13%)
LRR 5 148..168 6/20 (30%)
leucine-rich repeat 149..198 CDD:275380 14/50 (28%)
LRR 6 172..193 6/21 (29%)
LRR 7 198..219 5/21 (24%)
leucine-rich repeat 199..249 CDD:275380 13/57 (23%)
LRR 8 222..244 7/27 (26%)
LRR 9 249..270 6/21 (29%)
leucine-rich repeat 250..275 CDD:275380 7/25 (28%)
LRR 10 275..296 9/21 (43%)
leucine-rich repeat 276..299 CDD:275380 9/23 (39%)
LRR 11 299..320 3/21 (14%)
leucine-rich repeat 300..321 CDD:275380 3/21 (14%)
LRR 12 323..344 5/21 (24%)
LRR 13 356..377 5/21 (24%)
leucine-rich repeat 357..380 CDD:275380 5/23 (22%)
LRR 14 380..400 6/20 (30%)
leucine-rich repeat 381..406 CDD:275380 7/25 (28%)
LRR 15 408..429 8/21 (38%)
leucine-rich repeat 409..432 CDD:275380 10/23 (43%)
LRR 16 432..454 2/22 (9%)
leucine-rich repeat 433..457 CDD:275380 2/24 (8%)
leucine-rich repeat 458..481 CDD:275380 6/32 (19%)
LRR 17 465..486 6/31 (19%)
leucine-rich repeat 482..507 CDD:275380 9/28 (32%)
LRR 18 507..528 6/61 (10%)
leucine-rich repeat 508..531 CDD:275380 6/63 (10%)
LRR_RI <531..647 CDD:330982 28/121 (23%)
LRR 19 531..552 8/21 (38%)
leucine-rich repeat 532..563 CDD:275380 9/31 (29%)
LRR 20 563..584 7/23 (30%)
leucine-rich repeat 564..585 CDD:275380 7/23 (30%)
LRR 21 587..608 8/24 (33%)
leucine-rich repeat 588..611 CDD:275380 8/26 (31%)
LRR 22 611..632 2/21 (10%)
leucine-rich repeat 612..630 CDD:275380 2/18 (11%)
PCC 616..>688 CDD:188093 11/76 (14%)
leucine-rich repeat 637..659 CDD:275380 6/24 (25%)
TIR 755..900 CDD:214587 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.