DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and TLR1

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_003254.2 Gene:TLR1 HGNCID:11847 Length:786 Species:Homo sapiens

Alignment Length:818 Identity:187/819 (23%)
Similarity:293/819 (36%) Gaps:265/819 (32%)


  Fly   371 LDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGI-SGDIFSNLGNLVTLVMSRNRLRTIDSRAF 434
            :|.|.|.|.|:|..|...|   |.|.:..|.::.: :.||.| |..|..|::|.||::.:|...|
Human    29 VDRSKNGLIHVPKDLSQKT---TILNISQNYISELWTSDILS-LSKLRILIISHNRIQYLDISVF 89

  Fly   435 VSTNGLRHLHLDHN--------------DIDLQQPLLDIMLQTQINSPFGYMH-----GLLTLNL 480
            .....|.:|.|.||              .:||.....|.:   .|...||.|.     ||.|.:|
Human    90 KFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDAL---PICKEFGNMSQLKFLGLSTTHL 151

  Fly   481 RNNSIIFVYNDWKNTMLQLRELDLSYNNISS----LGY--------EDLAFLSQNRLHVNMTHNK 533
            ..:|:                |.:::.|||.    ||.        |.|...:...||:....||
Human   152 EKSSV----------------LPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNK 200

  Fly   534 IRRIALPEDVHLGEGYNNNLVHV-----------------DLNDNPLVCDCTI-----LW--FIQ 574
            .....|  ||.:....|..|.::                 .|..||.:.:.|:     .|  ||:
Human   201 EFHFIL--DVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIR 263

  Fly   575 LVRGVHKPQYSRQFKLRTDRLVCSQPNV------------LEGTPVRQIE-----------PQT- 615
            ::          |....|.....|..||            ..||.::.:.           ||: 
Human   264 IL----------QLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSY 318

  Fly   616 ----------------------LICP--------LDFSDDPRERKCPRGCNCHVRTYDKALVINC 650
                                  ::||        ||||::               .....:..||
Human   319 IYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNN---------------LLTDTVFENC 368

  Fly   651 HSGNLTH----VPRLPNLHKNMQLMELHLENNTLLRLP-SANTPGYE----------SVTSLHLA 700
              |:||.    :.::..|.:..::.|:..:..:|.:|. |.|:..|:          |:.||:::
Human   369 --GHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMS 431

  Fly   701 GNNLTSIDVDQLPTNLTHLDISWNH-------------LQMLNA-----------------TVL- 734
            .|.||......||..:..||:..|.             ||.||.                 :|| 
Human   432 SNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLI 496

  Fly   735 -----------GFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERI------GDRNEMMCV 782
                       .|.....|.||:|...||:.|.|.....:    .|.:::      |..:...|.
Human   497 IDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFV----KNIDQVSSEVLEGWPDSYKCD 557

  Fly   783 NAE-------MPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYA 840
            ..|       ....|.|||.|         ...|.|.|..|.|:...|......:   :.:..|.
Human   558 YPESYRGTLLKDFHMSELSCN---------ITLLIVTIVATMLVLAVTVTSLCSY---LDLPWYL 610

  Fly   841 HNLLLWFVTE--------EDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDW 897
            ..:..|..|.        |:|.::.:|.||||||..|..::::.|:|.||  .:..|:|:|||::
Human   611 RMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE--KEGMQICLHERNF 673

  Fly   898 LVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIG--D 960
            :.|..|.|||:..:..|.::|.|||.||::|||...|...||.:..:||.:.:|:|:...|.  .
Human   674 VPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYS 738

  Fly   961 VEKLDEELKAYLKMNTYLKWGDP-----WFWDKLRFAL 993
            :.....:||:.:...|||:|...     .||..||.|:
Human   739 IPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAI 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 52/203 (26%)
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
LRR_8 342..402 CDD:290566 11/31 (35%)
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 368..391 CDD:275380 8/20 (40%)
LRR_8 390..450 CDD:290566 19/75 (25%)
leucine-rich repeat 392..415 CDD:275380 7/24 (29%)
leucine-rich repeat 416..439 CDD:275380 7/23 (30%)
leucine-rich repeat 440..474 CDD:275380 12/53 (23%)
leucine-rich repeat 475..498 CDD:275380 4/23 (17%)
LRR_8 477..534 CDD:290566 15/69 (22%)
leucine-rich repeat 499..520 CDD:275380 8/33 (24%)
leucine-rich repeat 523..552 CDD:275380 8/29 (28%)
LRRCT 561..619 CDD:214507 16/111 (14%)
LRRNT 631..667 CDD:214470 6/40 (15%)
leucine-rich repeat 664..693 CDD:275380 7/40 (18%)
LRR_8 669..726 CDD:290566 17/81 (21%)
leucine-rich repeat 694..715 CDD:275380 7/21 (33%)
leucine-rich repeat 716..737 CDD:275380 10/63 (16%)
LRRCT 751..800 CDD:214507 13/62 (21%)
TIR 858..996 CDD:214587 51/144 (35%)
TLR1NP_003254.2 leucine-rich repeat 47..70 CDD:275378 8/27 (30%)
LRR 1 54..77 7/24 (29%)
LRR_8 69..124 CDD:316378 14/55 (25%)
leucine-rich repeat 71..94 CDD:275378 7/23 (30%)
LRR 2 78..101 7/23 (30%)
leucine-rich repeat 95..115 CDD:275378 5/20 (25%)
LRR 3 102..125 4/23 (17%)
leucine-rich repeat 116..140 CDD:275378 7/27 (26%)
LRR 4 126..150 8/27 (30%)
leucine-rich repeat 141..152 CDD:275378 4/11 (36%)
LRR 5 151..175 8/40 (20%)
LRR 6 176..199 4/23 (17%)
LRR 7 200..223 6/25 (24%)
LRR 8 224..250 3/26 (12%)
LRR 9 251..278 6/37 (16%)
LRR 10 279..308 4/29 (14%)
LRR 11 309..337 2/28 (7%)
Interaction with bacterial lipopeptide 313..316 1/3 (33%)
LRR 12 338..361 6/38 (16%)
PLN00113 <352..>560 CDD:331614 45/229 (20%)
leucine-rich repeat 352..373 CDD:275380 9/38 (24%)
LRR 13 362..388 6/28 (21%)
leucine-rich repeat 374..399 CDD:275380 2/25 (8%)
LRR 14 389..414 6/25 (24%)
leucine-rich repeat 400..424 CDD:275380 5/24 (21%)
LRR 15 415..437 6/22 (27%)
leucine-rich repeat 425..446 CDD:275380 7/21 (33%)
LRR 16 438..457 5/19 (26%)
leucine-rich repeat 447..469 CDD:275380 3/22 (14%)
LRR 17 458..478 4/20 (20%)
leucine-rich repeat 470..492 CDD:275380 4/22 (18%)
LRR 18 479..500 2/21 (10%)
leucine-rich repeat 494..515 CDD:275380 3/21 (14%)
LRR 19 501..524 5/23 (22%)
LRRCT 553..577 CDD:279765 6/24 (25%)
TIR 636..779 CDD:214587 51/144 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.