DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr8

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001094479.1 Gene:Tlr8 RGDID:1590327 Length:1029 Species:Rattus norvegicus

Alignment Length:1060 Identity:222/1061 (21%)
Similarity:379/1061 (36%) Gaps:356/1061 (34%)


  Fly   133 ESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLE 197
            |:.| |||||......|..|........:|..|||.|...::.||.::  .||.::..:....|.
  Rat   102 ENKN-GMNITEGAFLSLRNLTELLLEDNQLYTIPAGLPESLKELSLIQ--NNIFQVTKNNTFGLR 163

  Fly   198 NLESIEFG------SNKLRQMPRGIFGKMPKLKQLNLWSNQLHN--------------------- 235
            |||.:..|      .|::.::..|.|..:..||.|:|..|.|.:                     
  Rat   164 NLERLYLGWNCYFKCNQIFKVEDGAFNNLINLKLLSLSFNNLFSVPPKLPSSLSKLFLSNAKIST 228

  Fly   236 LTKHDFEGATSVLGIDIHDN--------------------GIEQLPHDVFAHLTNVTDINLSANL 280
            :|:.||:|...::.:|:..|                    .|..|   .|.:||.:..:|||:..
  Rat   229 ITQEDFKGLEHLILLDLSGNCPRCFNAPFPCESCNLSASIRIHPL---AFQNLTQLRFLNLSSTS 290

  Fly   281 FRSLPQGLFDHNKHLNEVRLMNNRVP--------LATLPS----------------RLFANQPEL 321
            .|::|...||:..:|.|:.|..|.:.        |..|||                :.....|..
  Rat   291 LRTIPSTWFDNLTNLKELHLEFNYLVQEIASGAFLTKLPSLQTLDLSFNFIHKEYLQYITISPNF 355

  Fly   322 QILR--------------LRAE----LQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNL 368
            .:||              |:.|    ||:||        .:|.|:||.|.::.:.....:...||
  Rat   356 SMLRSLRKLHLKGYVFRELKKEHFKPLQNLP--------NLTTINLGINFIEKIDFKAFQDFPNL 412

  Fly   369 LSLDLSNNRLTHL-------------------------PDSLFAHTT------------NLTDLR 396
            ..:.||.||:..:                         |...|.|:|            ...||.
  Rat   413 KVIYLSGNRIASVIDGTDHSSWRNRLRKPLSTDYDEFDPHMNFYHSTEPLIKPQCTTYGKALDLS 477

  Fly   397 LEDNLLTG-----------------------ISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTN 438
            |.:..:.|                       ::|..||::.::..|.::.|||...|::.|...:
  Rat   478 LNNIFVIGKSQFEGFQDIACLNLSFNANGQVLNGTEFSSMPHIKYLDLTNNRLDFDDNQTFSDLH 542

  Fly   439 GLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLL---TLNLRNNSIIFVYNDWKNTMLQLR 500
            .|..|.|.||        ........:....|::..|:   .|||.:|.|..:.:::|.....|:
  Rat   543 DLEVLDLSHN--------AHYFSIAGVTHRLGFIQNLIKLKVLNLSHNGIYTLTDEYKLQSKSLK 599

  Fly   501 ELDLSYNNISSL-----GYEDLAFLSQNRL-HVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLN 559
            ||..|.|.:..|     |.....|.|...| .:::::|.:::|  |.:..|  ....:|..:.:|
  Rat   600 ELVFSGNRLDRLWNANDGKYWSIFTSLETLTRLDLSYNNLQQI--PNEAFL--NLPQSLQELHIN 660

  Fly   560 DNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSD 624
            ||.|                      |.|                                    
  Rat   661 DNRL----------------------RFF------------------------------------ 667

  Fly   625 DPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTP 689
                                         |.|.:...|:||      .|.|..|.|..|.:..:.
  Rat   668 -----------------------------NWTLLQYFPHLH------VLDLGRNELYFLTNCLSK 697

  Fly   690 GYESVTSLHLAGNNLTSIDVDQL--PTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNP 752
            ...|:.:|.|..|:.:.:....|  ..||.:||:|:|.::|:|.:.|....:| ....:.|.||.
  Rat   698 FTHSLKTLLLNHNHFSHLPAGFLSEARNLVYLDLSFNTIKMINKSSLQTETKT-NLSVLDLQGNH 761

  Fly   753 WMCDCTAKPLLLFTQDN-FERIGDRNEMMCVNAEMPTRMVELSTNDICPAE---KGVFIALAVVI 813
            :.|.|.......:.::| ..||....:::|.|                |.:   |.|     :.:
  Rat   762 FDCTCDISDFRSWLEENPHVRIPRLVDVICSN----------------PGDQRWKSV-----MSL 805

  Fly   814 ALTGLLAGFTAAL--YYKFQTEIKIWLYA--HNLL---LWFV---------------TEEDLDKD 856
            .||..::..|||:  ::.|.|...:.|.|  |:|.   :||:               |.:..   
  Rat   806 DLTTCVSDTTAAILFFFTFLTTSTVLLAALVHHLFYWDVWFIYHMCSAKLRGYRSSSTSQTF--- 867

  Fly   857 KKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQ-----LCVHERDWLVGGHIPENIMRSVADSRR 916
              :||:|||..||.| :.|:::.:|.:..::.:     ||:.||||..|..|.:|:|:|:..|::
  Rat   868 --YDAYISYDTKDAS-VTDWVINELRYHLEESEDKSVLLCLEERDWDPGLPIIDNLMQSINQSKK 929

  Fly   917 TIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKM------N 975
            ||.||::.:.||...:..|..|.:..::|....||.|:...:       .:...||::      :
  Rat   930 TIFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPV-------LQYSQYLRLRQRICKS 987

  Fly   976 TYLKW-----GDPWFWDKLR 990
            :.|:|     .:..||..|:
  Rat   988 SILQWPNNPKAENLFWQSLK 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/65 (26%)
leucine-rich repeat 176..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..222 CDD:275380 6/29 (21%)
LRR_RI 216..542 CDD:238064 96/478 (20%)
LRR_8 221..281 CDD:290566 20/101 (20%)
leucine-rich repeat 223..270 CDD:275380 17/88 (19%)
leucine-rich repeat 271..294 CDD:275380 7/23 (30%)
leucine-rich repeat 295..320 CDD:275380 9/49 (18%)
leucine-rich repeat 321..343 CDD:275380 8/40 (20%)
LRR_8 342..402 CDD:290566 18/97 (19%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 9/60 (15%)
LRR_8 390..450 CDD:290566 19/95 (20%)
leucine-rich repeat 392..415 CDD:275380 7/46 (15%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 6/34 (18%)
leucine-rich repeat 475..498 CDD:275380 7/26 (27%)
LRR_8 477..534 CDD:290566 17/63 (27%)
leucine-rich repeat 499..520 CDD:275380 8/26 (31%)
leucine-rich repeat 523..552 CDD:275380 5/30 (17%)
LRRCT 561..619 CDD:214507 4/58 (7%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 7/29 (24%)
LRR_8 669..726 CDD:290566 16/59 (27%)
leucine-rich repeat 694..715 CDD:275380 4/23 (17%)
leucine-rich repeat 716..737 CDD:275380 8/21 (38%)
LRRCT 751..800 CDD:214507 8/50 (16%)
TIR 858..996 CDD:214587 41/150 (27%)
Tlr8NP_001094479.1 LRR_RI <49..291 CDD:238064 46/195 (24%)
LRR_8 62..130 CDD:290566 9/29 (31%)
leucine-rich repeat 62..85 CDD:275380
leucine-rich repeat 86..119 CDD:275380 8/18 (44%)
leucine-rich repeat 120..140 CDD:275380 6/20 (30%)
leucine-rich repeat 141..164 CDD:275380 5/25 (20%)
LRR_8 163..248 CDD:290566 18/85 (21%)
leucine-rich repeat 165..194 CDD:275380 6/29 (21%)
leucine-rich repeat 195..215 CDD:275380 6/20 (30%)
LRR_8 214..291 CDD:290566 14/80 (18%)
leucine-rich repeat 216..239 CDD:275380 4/23 (17%)
leucine-rich repeat 240..280 CDD:275380 7/43 (16%)
LRR_8 279..339 CDD:290566 16/60 (27%)
LRR_RI 280..608 CDD:238064 70/344 (20%)
leucine-rich repeat 281..304 CDD:275380 7/23 (30%)
leucine-rich repeat 305..324 CDD:275380 4/19 (21%)
leucine-rich repeat 331..387 CDD:275380 9/64 (14%)
LRR_8 359..422 CDD:290566 18/71 (25%)
leucine-rich repeat 388..411 CDD:275380 5/23 (22%)
leucine-rich repeat 467..494 CDD:275380 4/27 (15%)
leucine-rich repeat 495..510 CDD:275380 0/15 (0%)
LRR_8 518..584 CDD:290566 17/74 (23%)
leucine-rich repeat 520..543 CDD:275380 6/23 (26%)
LRR_RI 543..762 CDD:238064 62/325 (19%)
leucine-rich repeat 544..573 CDD:275380 7/37 (19%)
leucine-rich repeat 574..597 CDD:275380 6/23 (26%)
leucine-rich repeat 598..628 CDD:275380 9/30 (30%)
LRR_8 628..688 CDD:290566 20/157 (13%)
leucine-rich repeat 629..653 CDD:275380 5/28 (18%)
leucine-rich repeat 654..677 CDD:275380 10/110 (9%)
leucine-rich repeat 678..701 CDD:275380 7/29 (24%)
LRR_8 701..762 CDD:290566 18/62 (29%)
leucine-rich repeat 702..725 CDD:275380 4/23 (17%)
leucine-rich repeat 726..745 CDD:275380 8/19 (42%)
TPKR_C2 760..>798 CDD:301599 9/54 (17%)
TIR 868..1004 CDD:214587 40/144 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.