DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and TLR9

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_059138.1 Gene:TLR9 HGNCID:15633 Length:1032 Species:Homo sapiens

Alignment Length:1120 Identity:251/1121 (22%)
Similarity:385/1121 (34%) Gaps:375/1121 (33%)


  Fly    45 CAPI-MSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCM 108
            |.|: :|.....|....|..|| |.:...:.:.:..|...|.  ..|||.|              
Human    98 CPPVGLSPMHFPCHMTIEPSTF-LAVPTLEELNLSYNNIMTV--PALPKSL-------------- 145

  Fly   109 LPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRF---------TTRRLTH 164
                  |:..|.:..|     |:.:|.:|.         .||.| ||.|         ..|:...
Human   146 ------ISLSLSHTNI-----LMLDSASLA---------GLHAL-RFLFMDGNCYYKNPCRQALE 189

  Fly   165 IPANLLTDMRNLSHLELRAN-----IEEMPSHLF--------------DDLENLES---IEFGSN 207
            :....|..:.||:||.|:.|     ...:||.|.              :||.||.:   ::.|.|
Human   190 VAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGN 254

  Fly   208 KLR---------QMPR-------GIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNG 256
            ..|         :.||       ..|..:.:|:.|.|..:.|..|....|.|..::..:|:.:|.
Human   255 CRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENF 319

  Fly   257 IEQ--LPHDVFAHLTNVTDINLSANL--------------FRSL-------PQGLFDHNKHLNEV 298
            :.:  .....|..||.:..:|||.|.              |.||       ..|:|  .:.|:|.
Human   320 LYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIF--FRSLDET 382

  Fly   299 RLMNNRVPLATLPS----RL---FANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLL-- 354
            .|.    |||.||.    ||   |.||.:|.|.|      :.||        :..:.|.||.:  
Human   383 TLR----PLARLPMLQTLRLQMNFINQAQLGIFR------AFPG--------LRYVDLSDNRISG 429

  Fly   355 -KTLPATLLE----HQVNL--------------------------LSLDLSNNRLTHLPDSLFAH 388
             ..|.||:.|    .:|.|                          .:||||.|.|..:...:||.
Human   430 ASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQ 494

  Fly   389 TTNLTDLRLEDNLLT-GISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDL 452
            .::|..|||..|.:: .::|..|..|..|..|.:|.|:|......:|.....|..|.|.:|    
Human   495 LSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHSFTELPRLEALDLSYN---- 555

  Fly   453 QQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDL 517
                         :.||| |.|:      .::..||.:     :..||.|.|::|||.|...:.|
Human   556 -------------SQPFG-MQGV------GHNFSFVAH-----LRTLRHLSLAHNNIHSQVSQQL 595

  Fly   518 AFLSQNRLHVNMTHNKIRRIALPED--VHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVH 580
            ...|...|  :.:.|.:..:....|  :|..:|. :.|:.:||:.|                   
Human   596 CSTSLRAL--DFSGNALGHMWAEGDLYLHFFQGL-SGLIWLDLSQN------------------- 638

  Fly   581 KPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKA 645
                    :|.|                  :.|||                              
Human   639 --------RLHT------------------LLPQT------------------------------ 647

  Fly   646 LVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVD 710
                           |.||.|::|:  |.|.:|.|......:......:..|.||||.|.::...
Human   648 ---------------LRNLPKSLQV--LRLRDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNG 695

  Fly   711 QLP--TNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGN-------PW---------MCDC 757
            .||  |.|..||:|.|.:..:   ..||.::..:.|.:.||.|       .|         :.|.
Human   696 SLPAGTRLRRLDVSCNSISFV---APGFFSKAKELRELNLSANALKTVDHSWFGPLASALQILDV 757

  Fly   758 TAKPL-----------LLFTQDNFERIGDRNEMMCVNAEMPTRMVELS--TNDI----------- 798
            :|.||           ||..|.....:..|     |....|.::..||  ..|:           
Human   758 SANPLHCACGAAFMDFLLEVQAAVPGLPSR-----VKCGSPGQLQGLSIFAQDLRLCLDEALSWD 817

  Fly   799 CPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFV---TEEDLDKDK-KF 859
            |.|...:.:||.:.:.:...|.|:            .:|...|..|.|..   .:...|:|. .:
Human   818 CFALSLLAVALGLGVPMLHHLCGW------------DLWYCFHLCLAWLPWRGRQSGRDEDALPY 870

  Fly   860 DAFISYSHKDQSFIEDYLVPQLE------HGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTI 918
            |||:.:. |.||.:.|::..:|.      .|....:||:.|||||.|..:.||:..||..||:|:
Human   871 DAFVVFD-KTQSAVADWVYNELRGQLEECRGRWALRLCLEERDWLPGKTLFENLWASVYGSRKTL 934

  Fly   919 IVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTYLKW--- 980
            .||:.....|...|..|..|.:..|.:.:..::::|.|..|...:. ..|:..|...:.|.|   
Human   935 FVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRY-VRLRQRLCRQSVLLWPHQ 998

  Fly   981 --GDPWFWDKLRFAL 993
              |...||.:|..||
Human   999 PSGQRSFWAQLGMAL 1013

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 22/97 (23%)
leucine-rich repeat 176..198 CDD:275380 10/41 (24%)
leucine-rich repeat 199..222 CDD:275380 7/42 (17%)
LRR_RI 216..542 CDD:238064 94/390 (24%)
LRR_8 221..281 CDD:290566 16/76 (21%)
leucine-rich repeat 223..270 CDD:275380 12/49 (24%)
leucine-rich repeat 271..294 CDD:275380 9/44 (20%)
leucine-rich repeat 295..320 CDD:275380 13/32 (41%)
leucine-rich repeat 321..343 CDD:275380 5/22 (23%)
LRR_8 342..402 CDD:290566 22/93 (24%)
leucine-rich repeat 344..367 CDD:275380 8/30 (27%)
leucine-rich repeat 368..391 CDD:275380 9/49 (18%)
LRR_8 390..450 CDD:290566 18/61 (30%)
leucine-rich repeat 392..415 CDD:275380 8/24 (33%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 8/34 (24%)
leucine-rich repeat 475..498 CDD:275380 2/23 (9%)
LRR_8 477..534 CDD:290566 14/57 (25%)
leucine-rich repeat 499..520 CDD:275380 9/21 (43%)
leucine-rich repeat 523..552 CDD:275380 5/31 (16%)
LRRCT 561..619 CDD:214507 6/58 (10%)
LRRNT 631..667 CDD:214470 4/36 (11%)
leucine-rich repeat 664..693 CDD:275380 7/29 (24%)
LRR_8 669..726 CDD:290566 19/59 (32%)
leucine-rich repeat 694..715 CDD:275380 9/23 (39%)
leucine-rich repeat 716..737 CDD:275380 7/21 (33%)
LRRCT 751..800 CDD:214507 16/89 (18%)
TIR 858..996 CDD:214587 44/148 (30%)
TLR9NP_059138.1 leucine-rich repeat 43..64 CDD:275380
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 47..51
LRR 1 62..85
LRR_8 64..135 CDD:290566 9/38 (24%)
leucine-rich repeat 65..88 CDD:275380
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 72..77
LRR 2 87..110 3/12 (25%)
leucine-rich repeat 89..124 CDD:275380 8/27 (30%)
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 95..109 3/11 (27%)
LRR 3 122..147 7/47 (15%)
LRR_8 123..177 CDD:290566 18/91 (20%)
leucine-rich repeat 125..144 CDD:275380 5/21 (24%)
leucine-rich repeat 145..168 CDD:275380 9/57 (16%)
LRR 4 150..166 5/30 (17%)
LRR 5 167..190 6/24 (25%)
leucine-rich repeat 169..200 CDD:275380 6/32 (19%)
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 179..181 0/2 (0%)
LRR 6 198..221 8/23 (35%)
LRR_8 200..254 CDD:290566 14/54 (26%)
leucine-rich repeat 201..221 CDD:275380 7/20 (35%)
leucine-rich repeat 222..245 CDD:275380 5/23 (22%)
LRR 7 223..242 2/19 (11%)
LRR 8 243..268 4/25 (16%)
leucine-rich repeat 246..285 CDD:275380 6/39 (15%)
LRR 9 283..306 6/23 (26%)
LRR_8 284..344 CDD:290566 15/60 (25%)
leucine-rich repeat 286..307 CDD:275380 7/21 (33%)
LRR 10 308..332 3/24 (13%)
leucine-rich repeat 310..335 CDD:275380 5/25 (20%)
LRR 11 333..356 6/23 (26%)
leucine-rich repeat 336..365 CDD:275380 7/29 (24%)
LRR 12 363..386 6/29 (21%)
leucine-rich repeat 366..392 CDD:275380 10/32 (31%)
LRR 13 390..413 10/29 (34%)
leucine-rich repeat 393..416 CDD:275380 9/29 (31%)
LRR 14 415..440 9/33 (27%)
leucine-rich repeat 417..472 CDD:275380 9/55 (16%)
LRR 15 470..494 8/24 (33%)
LRR_RI 476..739 CDD:238064 86/390 (22%)
leucine-rich repeat 476..497 CDD:275380 8/21 (38%)
LRR_8 496..555 CDD:290566 17/59 (29%)
LRR 16 496..519 7/23 (30%)
leucine-rich repeat 498..522 CDD:275380 8/24 (33%)
LRR 17 520..543 7/23 (30%)
leucine-rich repeat 523..546 CDD:275380 6/23 (26%)
LRR 18 545..572 11/51 (22%)
leucine-rich repeat 547..599 CDD:275380 20/81 (25%)
LRR 19 574..598 9/24 (38%)
LRR_8 598..665 CDD:290566 23/162 (14%)
leucine-rich repeat 600..629 CDD:275380 5/32 (16%)
LRR 20 600..622 3/24 (13%)
LRR 21 627..650 10/114 (9%)
leucine-rich repeat 630..654 CDD:275380 13/114 (11%)
LRR 22 652..675 6/25 (24%)
leucine-rich repeat 655..678 CDD:275380 5/25 (20%)
LRR 23 676..699 8/23 (35%)
leucine-rich repeat 679..702 CDD:275380 9/23 (39%)
LRR_8 701..762 CDD:290566 16/64 (25%)
LRR 24 701..723 8/25 (32%)
leucine-rich repeat 703..726 CDD:275380 7/26 (27%)
LRR 25 724..747 5/23 (22%)
leucine-rich repeat 727..748 CDD:275380 5/21 (24%)
LRR 26 749..772 4/23 (17%)
leucine-rich repeat 752..770 CDD:275380 4/18 (22%)
TIR_2 870..1009 CDD:304906 41/141 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.