DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and TLR7

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_057646.1 Gene:TLR7 HGNCID:15631 Length:1049 Species:Homo sapiens

Alignment Length:1063 Identity:239/1064 (22%)
Similarity:413/1064 (39%) Gaps:266/1064 (25%)


  Fly   129 TLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLT--HIPANLLTDMRNLSHL---ELRANIEEM 188
            ||....:::.::.|.:||..:.|......|...||  |||.........|.||   :.|.|...:
Human    39 TLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPI 103

  Fly   189 P---------------SHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTK 238
            |               ...|..|..|:|:....|:|.::|:|:   .|.|:.|:|.:|.:.::.|
Human   104 PLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGL---PPSLQLLSLEANNIFSIRK 165

  Fly   239 HDFEGATSVLGIDIHDNG--------------IEQLPHDVFAHLTNVTDINLSANLFRSLPQGLF 289
               |..|.:..|:|...|              ||:   |.|.:||.:..::|..|...::|..| 
Human   166 ---ENLTELANIEILYLGQNCYYRNPCYVSYSIEK---DAFLNLTKLKVLSLKDNNVTAVPTVL- 223

  Fly   290 DHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRL-------------------RAELQSLPG 335
              ...|.|:.|.||.:  |.:....|.|..:||||.|                   .:.|| :|.
Human   224 --PSTLTELYLYNNMI--AKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQ-IPV 283

  Fly   336 DLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLT-HLPDSLFAH-TTNLTDLRLE 398
            :.|:..|::..:.|..|.|:.:|....::...|..||||.|.|. .:.|:.|.| ..:|..|.|.
Human   284 NAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLS 348

  Fly   399 DNL----------------------LTGISGDIFS-----------NLGNLVTLVMSRNRLRTID 430
            .|.                      :..|.|.:|.           ||.||..|.:..|.::..:
Human   349 FNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIAN 413

  Fly   431 SRAFVSTNGLRHLHLDHNDI----DLQQPLLDIMLQTQINS------------------------ 467
            ...|.....|:.:.|..|.|    |..:.......:|.:.|                        
Human   414 LSMFKQFKRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFK 478

  Fly   468 ----------PFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSL--GYE----- 515
                      ...|.:| .||:|..|||.||.:.....:..|:.|:||.|.||..  |.|     
Human   479 NKEASFMSVNESCYKYG-QTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLA 542

  Fly   516 DLAFL--SQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRG 578
            :|.:|  |.|||  ::.|:     ...|::|       .|..:|::.|.        .:.|....
Human   543 ELRYLDFSNNRL--DLLHS-----TAFEELH-------KLEVLDISSNS--------HYFQSEGI 585

  Fly   579 VHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYD 643
            .|...:::..|: ..:|:.:..::...|. |.:|.::| ..|:|..:..:.....|.|.:::.:.
Human   586 THMLNFTKNLKV-LQKLMMNDNDISSSTS-RTMESESL-RTLEFRGNHLDVLWREGDNRYLQLFK 647

  Fly   644 KAL---VINCHSGNLTHVP------RLPNLHKNMQLME-------------------LHLENNTL 680
            ..|   .::....:|:.:|      ..||| ||:.|.:                   |.|.:|.|
Human   648 NLLKLEELDISKNSLSFLPSGVFDGMPPNL-KNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQL 711

  Fly   681 LRLPSANTPGYESVTSLHLAGNNLTSI------DVDQLPTNLTHLDISWNHLQMLNATVL--GFL 737
            ..:|...:....|:.:|.|..|.:.|:      |..|    |.:||:|.|.:||:..|..  ..|
Human   712 TTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQ----LRYLDLSSNKIQMIQKTSFPENVL 772

  Fly   738 NRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERI------------GDRNEMMCVNAEMPTRM 790
            |..   :.:.|..|.::|.|.|...:.:.......|            |.......::.::.|  
Human   773 NNL---KMLLLHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYT-- 832

  Fly   791 VELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDK 855
            .||...::......:.::|.:::.:|.....|....|.....:.||..|          :..:..
Human   833 CELDLTNLILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGY----------QRLISP 887

  Fly   856 DKKFDAFISYSHKDQSFIE---DYLVPQLEHGPQK-FQLCVHERDWLVGGHIPENIMRSVADSRR 916
            |..:||||.|..||.:..|   ..||.:||...:| |.||:.|||||.|..:.||:.:|:..|::
Human   888 DCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKK 952

  Fly   917 TIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKM------N 975
            |:.|::..:.|:|..::.|..:|:..::| :..:|::|:     :||..::.| :|::      :
Human   953 TVFVMTDKYAKTENFKIAFYLSHQRLMDE-KVDVIILIF-----LEKPFQKSK-FLQLRKRLCGS 1010

  Fly   976 TYLKW-----GDPWFWDKLRFAL 993
            :.|:|     ..|:||..|:.||
Human  1011 SVLEWPTNPQAHPYFWQCLKNAL 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 19/77 (25%)
leucine-rich repeat 176..198 CDD:275380 8/40 (20%)
leucine-rich repeat 199..222 CDD:275380 7/23 (30%)
LRR_RI 216..542 CDD:238064 101/441 (23%)
LRR_8 221..281 CDD:290566 19/74 (26%)
leucine-rich repeat 223..270 CDD:275380 16/61 (26%)
leucine-rich repeat 271..294 CDD:275380 4/23 (17%)
leucine-rich repeat 295..320 CDD:275380 8/25 (32%)
leucine-rich repeat 321..343 CDD:275380 10/41 (24%)
LRR_8 342..402 CDD:290566 19/84 (23%)
leucine-rich repeat 344..367 CDD:275380 4/23 (17%)
leucine-rich repeat 368..391 CDD:275380 10/25 (40%)
LRR_8 390..450 CDD:290566 17/93 (18%)
leucine-rich repeat 392..415 CDD:275380 9/56 (16%)
leucine-rich repeat 416..439 CDD:275380 4/23 (17%)
leucine-rich repeat 440..474 CDD:275380 8/72 (11%)
leucine-rich repeat 475..498 CDD:275380 8/23 (35%)
LRR_8 477..534 CDD:290566 24/66 (36%)
leucine-rich repeat 499..520 CDD:275380 10/28 (36%)
leucine-rich repeat 523..552 CDD:275380 6/29 (21%)
LRRCT 561..619 CDD:214507 9/58 (16%)
LRRNT 631..667 CDD:214470 9/45 (20%)
leucine-rich repeat 664..693 CDD:275380 9/48 (19%)
LRR_8 669..726 CDD:290566 18/82 (22%)
leucine-rich repeat 694..715 CDD:275380 6/27 (22%)
leucine-rich repeat 716..737 CDD:275380 8/23 (35%)
LRRCT 751..800 CDD:214507 9/61 (15%)
TIR 858..996 CDD:214587 47/152 (31%)
TLR7NP_057646.1 LRR 1 43..64 4/21 (19%)
leucine-rich repeat 48..69 CDD:275380 5/21 (24%)
LRR 2 65..87 6/22 (27%)
LRR_8 75..139 CDD:316378 14/64 (22%)
leucine-rich repeat 91..128 CDD:275380 6/37 (16%)
LRR 3 110..126 1/16 (6%)
LRR 4 127..149 7/25 (28%)
leucine-rich repeat 129..173 CDD:275380 14/50 (28%)
LRR 5 151..170 6/22 (27%)
LRR 6 171..195 3/24 (13%)
PLN00113 191..>711 CDD:331614 118/556 (21%)
LRR 7 203..226 6/26 (23%)
leucine-rich repeat 206..225 CDD:275380 4/22 (18%)
leucine-rich repeat 227..250 CDD:275380 8/25 (32%)
LRR 8 228..247 6/21 (29%)
LRR 9 248..275 5/27 (19%)
leucine-rich repeat 251..291 CDD:275380 10/41 (24%)
LRR 10 289..312 5/23 (22%)
leucine-rich repeat 292..315 CDD:275380 4/23 (17%)
LRR 11 314..337 9/23 (39%)
leucine-rich repeat 316..341 CDD:275380 10/25 (40%)
LRR 12 339..368 4/29 (14%)
leucine-rich repeat 342..371 CDD:275380 4/29 (14%)
LRR 13 369..392 3/23 (13%)
leucine-rich repeat 372..398 CDD:275380 5/26 (19%)
LRR 14 396..419 6/23 (26%)
leucine-rich repeat 399..422 CDD:275380 4/23 (17%)
LRR 15 421..443 5/22 (23%)
LRR <488..775 CDD:227223 74/318 (23%)
LRR 16 492..515 10/24 (42%)
leucine-rich repeat 496..518 CDD:275380 8/22 (36%)
LRR 17 516..540 9/24 (38%)
leucine-rich repeat 519..543 CDD:275380 9/24 (38%)
LRR 18 541..564 8/30 (27%)
leucine-rich repeat 544..567 CDD:275380 9/37 (24%)
LRR 19 566..588 6/37 (16%)
leucine-rich repeat 568..597 CDD:275380 6/37 (16%)
LRR 20 595..618 5/25 (20%)
leucine-rich repeat 598..651 CDD:275380 10/55 (18%)
LRR 21 619..644 5/26 (19%)
leucine-rich repeat 621..643 CDD:275380 5/23 (22%)
LRR 22 649..672 3/23 (13%)
leucine-rich repeat 652..676 CDD:275380 3/24 (13%)
LRR 23 674..697 6/24 (25%)
leucine-rich repeat 677..700 CDD:275380 4/24 (17%)
LRR 24 698..721 5/23 (22%)
leucine-rich repeat 701..724 CDD:275380 5/23 (22%)
LRR 25 723..745 5/22 (23%)
leucine-rich repeat 725..748 CDD:275380 5/23 (22%)
LRR 26 746..769 9/27 (33%)
leucine-rich repeat 749..767 CDD:275380 8/18 (44%)
PCC 753..>837 CDD:188093 18/89 (20%)
LRR 27 772..795 7/26 (27%)
TIR 890..>993 CDD:214587 36/109 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.