DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr11

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001138251.2 Gene:Tlr11 RGDID:1564460 Length:932 Species:Rattus norvegicus

Alignment Length:1098 Identity:232/1099 (21%)
Similarity:387/1099 (35%) Gaps:342/1099 (31%)


  Fly    12 LLVIILQLLQWPGSEASFGRDACSEMSIDGL------CQCA-----PIMSEYEIICPANAENPTF 65
            |::|:|.|:               .:::.||      |..|     |.:|.|...|         
  Rat    19 LILILLTLV---------------SLNLTGLAWTIPDCIIADSLLFPNLSSYIPFC--------- 59

  Fly    66 RLTIQPKDYVQIMC----NLTDTTDYQQLPKKLRI----GEVD-----------RVQMRRCMLPG 111
              |:.|:.::...|    |:..|  .:::|:...:    |.|.           .:|:.|..| |
  Rat    60 --TLAPRLHLLASCSNVKNINQT--LEKVPRNTEVLCLQGMVPTLPANAFDGFYSLQLLRLQL-G 119

  Fly   112 HTPIASILDYLGIVSPTTLIFESDN---LGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDM 173
            .|.|.| ..:.|:.....|.||...   |.:.:....|:.|..|....|....||:..:..|.  
  Rat   120 TTNITS-RTFQGLDQLQYLFFEHHAPCCLSLFLPPDSLESLRSLSSLSFQGYCLTYSHSIYLP-- 181

  Fly   174 RNLSHLELR----ANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSN--- 231
            ..|.||.:|    ..::|: ..||.||     :...|:.....||     .|.|:.|:|..|   
  Rat   182 TTLRHLTMRNSCLTKLQEL-QRLFPDL-----LLGASSTPNTKPR-----TPFLEVLDLSYNLQL 235

  Fly   232 ------QLHNLTKHD--FEGATSVLGIDIHDN-------------GIEQLPHDVFAHLTNVTDIN 275
                  .|:.||.|.  .:| |.:..:|:..:             |||:||..| ...:.:..::
  Rat   236 KQAGIRDLYGLTLHSLILDG-TPLRALDLTSSGLLHLHFLSLVGTGIEKLPASV-TGFSELCALD 298

  Fly   276 LSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEH 340
            |..|..:::               |.|.                  .||.|:|            
  Rat   299 LGKNQIQNI---------------LGNG------------------DILGLKA------------ 318

  Fly   341 STQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRL---THLPDSLFAHTTNLTDLRLEDNLL 402
               :..:||.||.|::||...|.....|..|:||.|:|   ..||:.||  :||||.|.|..|.|
  Rat   319 ---LKFLSLHDNHLQSLPVRFLRTLPQLQKLNLSMNKLGPILELPEGLF--STNLTVLDLSHNQL 378

  Fly   403 TGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINS 467
            ..|....||.|..|..|.:|.|.:.::.:.:......||.|.|..|.|.:.:|           .
  Rat   379 CEIPRGNFSFLSQLQELWLSGNNISSLSNESLQGLRWLRTLDLSWNQIKVLKP-----------G 432

  Fly   468 PFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHN 532
            ...::..|.||||....:..:    ..|.||..::                              
  Rat   433 WLSHLPALTTLNLLGTYLEHI----SGTQLQGPKM------------------------------ 463

  Fly   533 KIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFK-------L 590
                                |.|:.|...|.: :...|||..|:....:.:...||.       |
  Rat   464 --------------------LRHLQLGSFPTL-EIYRLWFPMLLSLEIQAETYIQFMVPSGEPFL 507

  Fly   591 RTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNL 655
            ..:.|.....|:|       :||:|  ..:.|   |..|:..      :|.|  ::.::......
  Rat   508 FLENLTLETSNLL-------LEPKT--TTIHF---PSLRRLT------LRGY--SIFLSTSQLQS 552

  Fly   656 THVPRLPNLH------KNMQLMELHLENNTLLRLPSANTPG--YESVT-SLHLAGNNLTSIDVDQ 711
            ...|:||.|.      :|...::|||.....||:.......  |||.| .|.:..|.:..:.|  
  Rat   553 FFPPQLPLLEYFFVWCRNDDAVDLHLFEMPRLRVLELGNLNFFYESSTVKLEMLLNEVPQLQV-- 615

  Fly   712 LPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDR 776
                     ::.:||.:.|.:|..|..    .:|:||             |||.::...|...:.
  Rat   616 ---------LALSHLNLKNLSVSSFKG----LQSLKL-------------LLLNSERALEMNSNL 654

  Fly   777 NEMM-----------------CVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTA 824
            .|::                 |..:.:.:.........:...||.:.:|.|...:.| ||..|.|
  Rat   655 QELIPQIPQYVYFSDVTFACQCETSWLESWATRAPNTFVYGLEKPICMANASDYSKT-LLFSFLA 718

  Fly   825 ------ALYYKFQTEIKI--------------WLYAHNL------LLWFVTEEDLDKDKKFDAFI 863
                  ..::.|.|...:              |.:.|:|      ..|.:....|.....:|.||
  Rat   719 TNCPHGTEFWGFLTSFSLLLLLIILPLISCHKWSWLHHLWTLFHTCWWKLGGHRLRGQFNYDVFI 783

  Fly   864 SYSHKDQSFIEDYLVPQLEHGP---QKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNF 925
            ||..:||.::.:.|||.||..|   :..:||:..||:.:|....|:::.|:..||..:.||:...
  Rat   784 SYCEEDQDWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRAILCVLTGQA 848

  Fly   926 IKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLD-EELKAYLKMNTYLKWGD 982
            :.|.|..||.|.|....:....:..:::::     :|.|| ::|.:|.:::.:|:..|
  Rat   849 LASPWCNLELRLATYHLIARPGTTCLLLLF-----LEPLDRQKLHSYHRLSRWLQKED 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/72 (24%)
leucine-rich repeat 176..198 CDD:275380 9/26 (35%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 75/353 (21%)
LRR_8 221..281 CDD:290566 20/84 (24%)
leucine-rich repeat 223..270 CDD:275380 17/71 (24%)
leucine-rich repeat 271..294 CDD:275380 2/23 (9%)
leucine-rich repeat 295..320 CDD:275380 2/25 (8%)
leucine-rich repeat 321..343 CDD:275380 4/22 (18%)
LRR_8 342..402 CDD:290566 25/63 (40%)
leucine-rich repeat 344..367 CDD:275380 8/23 (35%)
leucine-rich repeat 368..391 CDD:275380 11/26 (42%)
LRR_8 390..450 CDD:290566 21/60 (35%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 4/23 (17%)
leucine-rich repeat 440..474 CDD:275380 7/34 (21%)
leucine-rich repeat 475..498 CDD:275380 7/23 (30%)
LRR_8 477..534 CDD:290566 7/57 (12%)
leucine-rich repeat 499..520 CDD:275380 0/21 (0%)
leucine-rich repeat 523..552 CDD:275380 0/29 (0%)
LRRCT 561..619 CDD:214507 14/65 (22%)
LRRNT 631..667 CDD:214470 6/42 (14%)
leucine-rich repeat 664..693 CDD:275380 9/37 (24%)
LRR_8 669..726 CDD:290566 13/60 (22%)
leucine-rich repeat 694..715 CDD:275380 4/22 (18%)
leucine-rich repeat 716..737 CDD:275380 5/21 (24%)
LRRCT 751..800 CDD:214507 6/66 (9%)
TIR 858..996 CDD:214587 37/130 (28%)
Tlr11NP_001138251.2 leucine-rich repeat 111..133 CDD:275380 8/24 (33%)
LRR_RI <179..427 CDD:238064 79/313 (25%)
leucine-rich repeat 224..246 CDD:275380 5/22 (23%)
leucine-rich repeat 248..270 CDD:275380 4/23 (17%)
LRR_8 270..329 CDD:290566 18/108 (17%)
leucine-rich repeat 271..293 CDD:275380 6/23 (26%)
leucine-rich repeat 294..318 CDD:275380 7/57 (12%)
LRR_8 319..378 CDD:290566 25/61 (41%)
leucine-rich repeat 319..342 CDD:275380 8/23 (35%)
leucine-rich repeat 343..367 CDD:275380 11/26 (42%)
LRR_8 366..426 CDD:290566 21/60 (35%)
leucine-rich repeat 368..391 CDD:275380 10/23 (43%)
leucine-rich repeat 392..415 CDD:275380 4/23 (17%)
LRR_8 416..471 CDD:290566 18/120 (15%)
leucine-rich repeat 416..437 CDD:275380 7/32 (22%)
leucine-rich repeat 440..463 CDD:275380 8/27 (30%)
leucine-rich repeat 533..583 CDD:275380 11/58 (19%)
leucine-rich repeat 584..612 CDD:275380 8/28 (29%)
leucine-rich repeat 613..633 CDD:275380 6/31 (19%)
TIR_2 781..>861 CDD:290400 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.