DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and CG5810

DIOPT Version :10

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:438 Identity:97/438 - (22%)
Similarity:174/438 - (39%) Gaps:88/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLE-LRANIEEMP 189
            |.:.:.:.|:|:..::.:.....||        :..|.::|..:..::..|.... |...::::.
  Fly    47 SASAVAYFSENVTKHLRKYETLVLH--------SSDLANLPRKIFLNLPQLVEFHVLECELQQIE 103

  Fly   190 SHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHD 254
            |..||..:||:.:.||.|.||.:....|....:|::|||..|||.:|....|....::..|::.:
  Fly   104 SVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSN 168

  Fly   255 NGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLF-DHNKHLNEVRLMNNRVPLATLPSRLFAN- 317
            |.:..|...:|:.|.::..||:.:|....||..|| |..|||:|....:|:  |..:|..:|.. 
  Fly   169 NRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQ--LVRIPFNIFREI 231

  Fly   318 -------QPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSN 375
                   .|:|:.|.|.|::..|...    :..:.::.|...::    ...||....|..|.:|.
  Fly   232 DHLSLSFNPQLRRLHLSAKINELEAT----NCDLESVELDGRVI----GVQLEANPKLHELKISQ 288

  Fly   376 NR-LTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNG 439
            .: |.|    |:...|||..|            |..|....||.|.:: :.:...|.....|..|
  Fly   289 PQDLEH----LYLANTNLYRL------------DFLSKASKLVDLDVT-DIVNLADLPKITSAKG 336

  Fly   440 LRHL-----HLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQL 499
            |..|     :|..|.:|:...|.|:              ..|.::......||:           
  Fly   337 LERLSFTYDNLTSNHMDMLPHLKDL--------------NYLEISHEKGKEIFI----------- 376

  Fly   500 RELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGE 547
            ::||           ||. |:.:..|:.....:.:..:.||:|..:.|
  Fly   377 KDLD-----------EDF-FVEEAELNCGQLADLLEFVELPKDTTILE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:404697 18/59 (31%)
leucine-rich repeat 176..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..222 CDD:275380 7/22 (32%)
LRR 222..576 CDD:443914 77/341 (23%)
leucine-rich repeat 223..270 CDD:275380 14/46 (30%)
leucine-rich repeat 271..294 CDD:275380 8/23 (35%)
leucine-rich repeat 295..320 CDD:275380 6/32 (19%)
leucine-rich repeat 321..343 CDD:275380 5/21 (24%)
leucine-rich repeat 344..367 CDD:275380 3/22 (14%)
leucine-rich repeat 368..391 CDD:275380 6/23 (26%)
leucine-rich repeat 392..415 CDD:275380 4/22 (18%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
leucine-rich repeat 440..474 CDD:275380 7/38 (18%)
leucine-rich repeat 475..498 CDD:275380 3/22 (14%)
leucine-rich repeat 499..520 CDD:275380 4/20 (20%)
leucine-rich repeat 523..552 CDD:275380 5/25 (20%)
LRRCT 561..619 CDD:214507
LRRNT 631..667 CDD:214470
PPP1R42 <660..752 CDD:455733
leucine-rich repeat 664..693 CDD:275380
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
CG5810NP_650952.2 LRR <61..353 CDD:443914 78/326 (24%)
leucine-rich repeat 65..88 CDD:275380 4/30 (13%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..209 CDD:275380 8/23 (35%)
leucine-rich repeat 210..231 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.