DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and MstProx

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_649719.2 Gene:MstProx FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster

Alignment Length:1111 Identity:253/1112 (23%)
Similarity:433/1112 (39%) Gaps:340/1112 (31%)


  Fly    67 LTIQPKDYVQI----MCNLT--------------DTTDYQQLPKKLRIGEVD------------- 100
            ||| |.||.:.    :||.|              .|.:|..:   :|.|.::             
  Fly     5 LTI-PDDYCETYCGGICNDTVASKTCDREAYDYIATNEYHLI---MRDGHLEVNWKIPDPNIFII 65

  Fly   101 -------RVQMRRCMLPGHT-PIASILDY---LGIVSPTTLIFESDNLGMNITRQHLDRLHGLKR 154
                   |:::...::...: ||.:: ||   ||:.:.|.  ||:......:..:.:..::|.|.
  Fly    66 SPISKENRLKLNELIVSDTSYPIRAV-DYLRQLGVETVTR--FENQINSFKVIERDVHYINGPKS 127

  Fly   155 FRFTTRRLTHIP-----ANLLTDMRNLSHLELRA--NIEE----MPSHLFDDLENLESIEFGSNK 208
            .:...:...::.     .|..||  |::.:.:.|  .:|.    :.:.:|:...:|.|:.|...:
  Fly   128 LKIIIQSNLYLNEIIEYINKTTD--NVNEIIINAYKTVENQQIALDNLIFNGKSHLRSLTFIGFQ 190

  Fly   209 LRQMPRGIFGKMPKLKQLNLWSNQLHNLT-KHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVT 272
            :..:....|.:...||::.|.:..:.||| ....:.:...|.:|| ||.::      ..:.||.:
  Fly   191 IENLSTKPFAQFINLKRMVLTNCTVRNLTFLRTLQKSLEHLELDI-DNEVD------LKYFTNFS 248

  Fly   273 DINLSANLFRSLPQ----GLFDHNKHLNEVRLMNNRVPLATLPSRLF-----------ANQPELQ 322
            .:.. ..:...:|.    .|...:|:.|.:|.:|. :....|...|:           :|...||
  Fly   249 SLKF-MKVRNYIPNKNFTALICTHKNCNFIRGING-LECPKLCQCLYIIDDLELNIDCSNLGLLQ 311

  Fly   323 ILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLT-----HLP 382
            |..|  .:.|..|         ..::..:|.|..||...|.....:..||:|.||||     |||
  Fly   312 IPPL--PIPSYGG---------VKLNFSNNSLSQLPTMTLPGYKLVKRLDVSRNRLTNLSINHLP 365

  Fly   383 DSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDH 447
            ..|             |.|  .:|.:...|:||.|.     ..|||:.  .|..|.....:|.| 
  Fly   366 AKL-------------DYL--DVSFNEIINMGNDVI-----KYLRTVP--IFKQTGNQWTIHCD- 407

  Fly   448 NDIDLQQPLLD--------IMLQTQINSPFGYMHGLLTL-------------------------- 478
                 .:|||:        |.:::....|. ::|.|..|                          
  Fly   408 -----DKPLLNFFRHLKLIIRMKSAEMKPM-FLHSLTELPKGFLKFLGKHFIWLGVRKQEYYLIN 466

  Fly   479 -------------NLRNNSIIFVYNDWKNTMLQL--RELDLSY---------------------- 506
                         ||.....|:.|.:|.:..|..  ||.||.|                      
  Fly   467 EEQLLQSMHRKLNNLNTIMSIYKYMEWLHRKLIFVNREYDLFYIRQMAAPCPHKCECCYSRDSLI 531

  Fly   507 ------------------NNISSLGYEDLAFLSQNRLHVNMTHNKIRRIA---LPEDVHLGEGYN 550
                              .|...:|.::::  |...||  ::.|.|..|.   ||:::...:...
  Fly   532 LKIDCRNKFVYNFPDIVARNSRLMGKQNMS--SPMELH--LSKNNISNITIAMLPKELRFLDLRF 592

  Fly   551 NNLVHVD---------------LNDNPLVCDCTILWFIQLVRGVHKP-QYSRQFKLRTDRLVCSQ 599
            ||||.:|               |:.||..|||.....:.::|. |:| :|....|.      |: 
  Fly   593 NNLVTLDDKVLSYLKKNSIKTKLSGNPWNCDCKSRSVLSILRD-HEPLEYDVTLKR------CN- 649

  Fly   600 PNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYD-KALVINCHSGNLTHVPRLPN 663
                             |.|.|         ||..|.|.:.... .:.:::|....|..:|.|.:
  Fly   650 -----------------ISPTD---------CPDVCVCCLDNLTWPSFIVDCRGEGLLQMPSLSS 688

  Fly   664 LHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQM 728
                                         .||.:.|..||||::.    ..|.:.::        
  Fly   689 -----------------------------RVTYVDLRNNNLTALS----QKNRSSIE-------- 712

  Fly   729 LNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVEL 793
                     ||::|   :.|..|||.|.|.....:.|.:.....|.|..|:.|.|.|   ::|.:
  Fly   713 ---------NRSLK---LHLLDNPWSCSCNDIEKINFMKSVSSSIVDFTEIKCSNGE---KLVSI 762

  Fly   794 STNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKK 858
            :.:.:||::...::|||:.:..|.:...|   |.: |:..:.:|.|.|.:.|....:.:|||||:
  Fly   763 NQHIVCPSDLFYYLALAISLVATIIALNF---LIW-FRQPVLVWFYEHGVCLSLSAKRELDKDKR 823

  Fly   859 FDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQ 923
            ||||::::|||::.:|:: |.:||.|..:||||.:.||||.|..||:.|.:|:.||||.|:::::
  Fly   824 FDAFLAFTHKDEALLEEF-VDRLERGRPRFQLCFYLRDWLAGESIPDCIGQSIKDSRRIIVLMTE 887

  Fly   924 NFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTYLKWGDPWFWDK 988
            ||:.|.|.|||||.|..:...:...|:||::|.::.:.:.||.||:.|:..||||:...|.||:|
  Fly   888 NFMNSTWGRLEFRLALHATSRDRCKRLIVVLYPNVKNFDSLDSELRTYMAFNTYLERSHPNFWNK 952

  Fly   989 LRFALP 994
            |.:::|
  Fly   953 LIYSMP 958

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 11/65 (17%)
leucine-rich repeat 176..198 CDD:275380 3/28 (11%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 88/439 (20%)
LRR_8 221..281 CDD:290566 13/61 (21%)
leucine-rich repeat 223..270 CDD:275380 12/48 (25%)
leucine-rich repeat 271..294 CDD:275380 3/27 (11%)
leucine-rich repeat 295..320 CDD:275380 6/36 (17%)
leucine-rich repeat 321..343 CDD:275380 6/22 (27%)
LRR_8 342..402 CDD:290566 18/65 (28%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 11/28 (39%)
LRR_8 390..450 CDD:290566 14/60 (23%)
leucine-rich repeat 392..415 CDD:275380 5/23 (22%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 8/42 (19%)
leucine-rich repeat 475..498 CDD:275380 8/62 (13%)
LRR_8 477..534 CDD:290566 18/138 (13%)
leucine-rich repeat 499..520 CDD:275380 7/63 (11%)
leucine-rich repeat 523..552 CDD:275380 8/32 (25%)
LRRCT 561..619 CDD:214507 12/59 (20%)
LRRNT 631..667 CDD:214470 8/37 (22%)
leucine-rich repeat 664..693 CDD:275380 0/29 (0%)
LRR_8 669..726 CDD:290566 8/57 (14%)
leucine-rich repeat 694..715 CDD:275380 7/21 (33%)
leucine-rich repeat 716..737 CDD:275380 0/21 (0%)
LRRCT 751..800 CDD:214507 14/49 (29%)
TIR 858..996 CDD:214587 59/138 (43%)
MstProxNP_649719.2 leucine-rich repeat 325..345 CDD:275378 5/20 (25%)
leucine-rich repeat 346..367 CDD:275378 10/21 (48%)
leucine-rich repeat 563..583 CDD:275378 7/22 (32%)
leucine-rich repeat 585..610 CDD:275378 5/25 (20%)
leucine-rich repeat 611..622 CDD:275378 3/11 (27%)
TIR 823..960 CDD:214587 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24365
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.