DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr8b

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_017213609.1 Gene:tlr8b ZFINID:ZDB-GENE-040219-12 Length:1015 Species:Danio rerio

Alignment Length:1090 Identity:231/1091 (21%)
Similarity:397/1091 (36%) Gaps:348/1091 (32%)


  Fly   149 LHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMP 213
            :|..:.:.:..|:|   |.::     |||:..:                   :::.....|:::|
Zfish    11 VHSSEGYNWAWRKL---PCDV-----NLSNTSV-------------------TLDCSERYLKKIP 48

  Fly   214 RGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHD----VFAHLTNVTDI 274
            :.:..   ....|||.:|::||::|..|....:|..||:..|.||:. |:    ||:.|||:..:
Zfish    49 KNLIW---NTTNLNLANNKIHNISKDAFWNLNNVTWIDLRRNQIEKC-HEKDNGVFSRLTNLKTL 109

  Fly   275 NLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLR--------AELQ 331
            .|..|....||:.|   ...|..:.|.:|.:  .::....|....:|.:|:|.        ||| 
Zfish   110 LLDNNKISVLPKNL---PAGLQWLSLNSNHI--KSIEQSDFKGMTKLTVLKLNKNCYHNISAEL- 168

  Fly   332 SLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNL---- 392
            ::..:.|:| .|:|.:.|..|.|..:|..|..   .|.:|.|..||:.|:.:|...|.|.|    
Zfish   169 TIQNETFQH-LQLTELQLSKNGLHNVPFALPR---TLHNLSLLLNRIDHVHESDLNHLTRLKVLD 229

  Fly   393 ---------------TDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRH 442
                           |..:..:|.|. |..:.||.|..|..|.:|.|.|::|:|..|.:...|::
Zfish   230 LSGNCPICFTTPFPCTSCQTNNNALQ-IHPNAFSKLSQLQDLRLSGNSLQSINSMWFQNLTNLKY 293

  Fly   443 LHLDHN---------------------DIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSII 486
            |:|..|                     ||....|...|..:.:::..|..:..|.||:|..    
Zfish   294 LYLSFNSLISEFESGQFFSVLPQVEVVDISYNNPSERIYPRLKLSEGFSRLESLQTLHLEG---- 354

  Fly   487 FVYNDWKNTMLQLRELDL----SYNNISSLGYEDLA--FLSQNRLHVNMTHNKIRRIALPED--- 542
            ::::       :|.|.||    |..|:|.|   :||  ||.|..|.|....:.:..|:|.::   
Zfish   355 YIFH-------KLSEDDLRPLFSLRNLSVL---NLAVNFLQQVNLSVFRNFHNLSLISLIDNRLT 409

  Fly   543 -----------------------------VHLGEGY---------------------NNNLVHVD 557
                                         :|..|.:                     .||:.|| 
Zfish   410 FSSPIRRWEGQSKSGFKDDNQGDHREGPYIHTNEEFRHYPPFTKAECLATGPVLDLSRNNIYHV- 473

  Fly   558 LNDNP--------LVC-DCTILWFIQLVRG---VHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQ 610
               ||        :.| :.:..:.:....|   .|.|:. :...|..:|:.....:.|......:
Zfish   474 ---NPPLFTGAENITCLNLSSNFIVSYFNGTEFAHFPKL-KYLDLSHNRIYMHSDSALSELKALE 534

  Fly   611 IEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLH-KNMQLMELH 674
            :        ||.|.           |.|.  ::.|.|.||    ||.:..|..|. .|:...|::
Zfish   535 V--------LDLSH-----------NQHY--FEVAGVRNC----LTFLENLQFLKVLNLSWNEIN 574

  Fly   675 LENNTLLRLPSAN---------------TPGYES-------VTSLHLAGNNLTSI--DV-DQLPT 714
            :..|..|:..|.|               ..||:|       :|.|.::.|.|:.|  |: |..|.
Zfish   575 MLTNKTLQSDSLNELQFQGNRLDIMWKKQRGYQSLFKSLSNLTYLDISYNKLSEIPDDIFDYFPK 639

  Fly   715 NLTHL--------DISWNHLQML------------------------------------------ 729
            .|.::        |.:|..||.|                                          
Zfish   640 TLRYISMSRNTLTDFAWEQLQSLPQLETLDLSKNKLRVVPRKLSKHTRSLKVLDLSHNQISKLRY 704

  Fly   730 -------NATVLGFLNRTMK--------------WRSVKLSGNPWMCDCTAKPLLLFTQDN---F 770
                   :..:|.|.|..:|              .:.:.|..||..|.|.....:|:.:.:   .
Zfish   705 SFLENVKSLQILNFANNKLKHLGASSFTTGSNHQLQILDLQRNPIHCTCNLLDFILWLEKSDTIL 769

  Fly   771 ERIGDRNEMMCVNAEMPTR-----MVELSTNDIC---PAEKGVFIALAVVIALTGLLAGFTAALY 827
            .|:.  .:::|   ::|..     ||.|...:.|   ...:.::|..:.||.|...    |....
Zfish   770 PRLA--TDVLC---DLPESKRGHPMVSLDFKNACINNSIAEILYILTSSVITLVMC----TTIGI 825

  Fly   828 YKFQTEIKIWLYAHNLLL-----WFVTEEDLDKDKKFDAFISYSHKDQSFIE---DYLVPQLE-H 883
            :.|..:|.   ||:|..:     :::...|.    .:|||:.|..||....|   ::|..:|| .
Zfish   826 HVFYWDIS---YAYNFCMARFKSYYLKTNDC----IYDAFVMYDTKDPMVAEWVLNHLRLELEDR 883

  Fly   884 GPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRS 948
            |.....||:.||||..|..|.:|:..||..||:||.||::.|:.|...::....|.:..|.||..
Zfish   884 GRHVRPLCLEERDWTPGIPIMDNLNLSVHRSRKTIFVLTEGFVHSGIFKMAAFLAQQRLLEEGVD 948

  Fly   949 RIIVIIYSDIGDVEKLDEELKAYLKMNTYLKW-----GDPWFWDKLRFAL 993
            .:::::...:....:: ..|:..|..::.|:|     .:.|||..||.|:
Zfish   949 VMVLVLLEPVLRQSRI-LNLRRCLCGHSVLEWPRNPAAEGWFWQSLRNAV 997

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 9/59 (15%)
leucine-rich repeat 176..198 CDD:275380 2/22 (9%)
leucine-rich repeat 199..222 CDD:275380 2/23 (9%)
LRR_RI 216..542 CDD:238064 99/384 (26%)
LRR_8 221..281 CDD:290566 22/64 (34%)
leucine-rich repeat 223..270 CDD:275380 19/51 (37%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 4/25 (16%)
leucine-rich repeat 321..343 CDD:275380 8/30 (27%)
LRR_8 342..402 CDD:290566 19/79 (24%)
leucine-rich repeat 344..367 CDD:275380 6/23 (26%)
leucine-rich repeat 368..391 CDD:275380 9/23 (39%)
LRR_8 390..450 CDD:290566 22/100 (22%)
leucine-rich repeat 392..415 CDD:275380 8/42 (19%)
leucine-rich repeat 416..439 CDD:275380 8/23 (35%)
leucine-rich repeat 440..474 CDD:275380 9/55 (16%)
leucine-rich repeat 475..498 CDD:275380 4/23 (17%)
LRR_8 477..534 CDD:290566 18/63 (29%)
leucine-rich repeat 499..520 CDD:275380 11/27 (41%)
leucine-rich repeat 523..552 CDD:275380 7/82 (9%)
LRRCT 561..619 CDD:214507 9/70 (13%)
LRRNT 631..667 CDD:214470 10/37 (27%)
leucine-rich repeat 664..693 CDD:275380 9/45 (20%)
LRR_8 669..726 CDD:290566 19/90 (21%)
leucine-rich repeat 694..715 CDD:275380 8/24 (33%)
leucine-rich repeat 716..737 CDD:275380 8/78 (10%)
LRRCT 751..800 CDD:214507 12/60 (20%)
TIR 858..996 CDD:214587 44/146 (30%)
tlr8bXP_017213609.1 leucine-rich repeat 36..57 CDD:275380 2/24 (8%)
leucine-rich repeat 58..78 CDD:275380 8/20 (40%)
LRR_8 78..137 CDD:290566 20/63 (32%)
leucine-rich repeat 79..105 CDD:275380 11/27 (41%)
leucine-rich repeat 106..121 CDD:275380 4/15 (27%)
LRR_8 126..190 CDD:290566 16/68 (24%)
leucine-rich repeat 127..150 CDD:275380 4/25 (16%)
leucine-rich repeat 151..179 CDD:275380 8/30 (27%)
leucine-rich repeat 180..224 CDD:275380 15/47 (32%)
LRR_8 199..277 CDD:290566 21/82 (26%)
leucine-rich repeat 225..266 CDD:275380 8/42 (19%)
LRR_8 265..354 CDD:290566 21/89 (24%)
leucine-rich repeat 267..290 CDD:275380 8/23 (35%)
LRR_RI 294..613 CDD:238064 66/363 (18%)
leucine-rich repeat 347..373 CDD:275380 9/37 (24%)
leucine-rich repeat 374..397 CDD:275380 9/26 (35%)
LRR_8 462..519 CDD:290566 12/62 (19%)
leucine-rich repeat 462..483 CDD:275380 6/25 (24%)
leucine-rich repeat 484..508 CDD:275380 4/24 (17%)
LRR_8 507..573 CDD:290566 19/92 (21%)
leucine-rich repeat 509..532 CDD:275380 3/24 (13%)
leucine-rich repeat 563..615 CDD:275380 10/52 (19%)
leucine-rich repeat 586..607 CDD:275380 3/21 (14%)
LRR_8 614..675 CDD:290566 14/61 (23%)
LRR_RI 616..>749 CDD:238064 21/133 (16%)
leucine-rich repeat 616..640 CDD:275380 8/24 (33%)
leucine-rich repeat 641..664 CDD:275380 6/23 (26%)
leucine-rich repeat 665..688 CDD:275380 0/23 (0%)
LRR_8 687..749 CDD:290566 7/62 (11%)
leucine-rich repeat 689..712 CDD:275380 0/23 (0%)
leucine-rich repeat 713..732 CDD:275380 4/19 (21%)
LRRCT 747..795 CDD:214507 11/53 (21%)
TIR 855..997 CDD:214587 44/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.