DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr22

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001122147.2 Gene:tlr22 ZFINID:ZDB-GENE-040220-5 Length:955 Species:Danio rerio

Alignment Length:1043 Identity:228/1044 (22%)
Similarity:398/1044 (38%) Gaps:297/1044 (28%)


  Fly   124 IVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANL-LTDMRNLSHLELRANIEE 187
            :|||.: .|...|..::.:::.:.....:..::.....:..:|.|. :.|:...|..:::  ||:
Zfish    24 MVSPCS-TFSLTNCTISSSQKDIKTQPKVLCYKMNFFTIPRVPNNTWILDISFNSFAQIQ--IED 85

  Fly   188 MPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDI 252
            :     :.|.||:.:...:||:.::..|.||.:..|..|||.||:|:.::.....|.|::|.:.:
Zfish    86 L-----NILLNLQYLNVSNNKISKIQDGAFGSLFNLTDLNLASNRLNAVSNGMLRGLTNLLVLRL 145

  Fly   253 HDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVR------------------ 299
            ..|.|..:....|:.|.::..:|||.|           |.:|:::|:                  
Zfish   146 DRNYISVIKESAFSTLHSLQVLNLSKN-----------HLRHIDDVKPVLASLYLEELYIGSNYF 199

  Fly   300 -------------------LMNNRVPLATLPSRLF---------------------------ANQ 318
                               |.|||.....|.:.:|                           |:.
Zfish   200 NVFNSSELSTKPLSLKRLDLSNNRFAAFQLTNNIFPTLNHLDLSYCGHNGTMAWNVTEKSYLASV 264

  Fly   319 PELQILRLRAELQSLPGDLFEHSTQITNISLGDN--LLKT---------------LPATLLEHQV 366
            ..|..:.:...:|:....|...:..:..|.|..|  |.||               |.||.::|..
Zfish   265 KTLYFMDVNMSIQTADNVLQSFNNTLNKIRLNGNVRLNKTSLLLSVCSPMLRVLRLIATKIKHLT 329

  Fly   367 N--------LLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSR 423
            |        |..|||..|.:::|..|:|.....|..|:|:.|.||.::.. |..|.:|..:.:||
Zfish   330 NHMFDPCSELSELDLGGNEISNLSQSMFRGFKQLKKLQLQINKLTRVTNS-FQILTSLEFIDLSR 393

  Fly   424 NRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFV 488
            |.:..:....|.:...::.|:|..|.|...:..|           |..:..|..|.|..|:::.:
Zfish   394 NHIHKLSCNDFANLTQVKTLYLYSNKISSIRSCL-----------FKDLKSLEVLRLGTNNLLKI 447

  Fly   489 YNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQ-NRLHVNMTHNKIRRIALPEDVHLGEGYN-- 550
            .:.:.|....|:||.||||.:|.:.......|.| |.|  ::..|:|..|         |||.  
Zfish   448 DDVFSNGPYFLKELQLSYNKLSLIKSHTFGNLPQLNNL--SLEDNQISEI---------EGYAFG 501

  Fly   551 --NNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEP 613
              .||..:.|:.|.:                            |.:.:.:.|||..|.|..|   
Zfish   502 GLENLTSLFLSSNKI----------------------------TGKTLTTHPNVFSGMPNLQ--- 535

  Fly   614 QTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENN 678
                 .||..           .|.....|||           ...|...:| ||::.:.|:.:..
Zfish   536 -----NLDLF-----------ANSISFAYDK-----------LKYPLFKDL-KNLRELSLYSQRR 572

  Fly   679 TLLRLPSANTPGYESVTSLHLAGNNLTSI----------------------DVDQLP-------T 714
            .:.:|||....|..|:...::...||..:                      :.|.:|       .
Zfish   573 GIGQLPSNLLEGLSSLQMFYIGNTNLNQLNPNLFNFTPQLWFLDLSKNALREDDAIPPELFHPIP 637

  Fly   715 NLTHLDISWNHLQMLNATVLGFLNRTMKWRS---------------------VKLSGNPWMCDCT 758
            |||.|.||...|:.||..:...||:....|:                     :.|..|.:.|||.
Zfish   638 NLTKLIISRTQLRSLNFLLGANLNKLSTLRASGNEIDSVNETLIKSLPRLAVLDLQNNTFTCDCN 702

  Fly   759 AKPLLLFTQDNFERIGDRNEMMCV------NAEMP-----TRMVELSTND-------ICPAEKGV 805
            ....:.:.:        :||...|      ....|     |.:.|.:|:.       ||      
Zfish   703 NAFFIDWAK--------KNESTQVYYLSRYTCSYPRTLRGTSLAEFNTDSCTFNWDYIC------ 753

  Fly   806 FIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDK---KFDAFISYSH 867
            |:..::::.||.||:.....|.|:.       :|.:.|.|.|:.:...::..   ::||||||:.
Zfish   754 FVCSSILVILTLLLSFIWNFLRYQV-------VYTYYLFLAFLYDSRRNQSGQTFQYDAFISYNT 811

  Fly   868 KDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWAR 932
            .|::::.:.|:|:|| |.|.::||:|.||:..|..|.:||:..:..||:||.::::|::||.|..
Zfish   812 LDEAWVMEELIPKLE-GEQGWRLCLHHRDFEPGRPIIDNIVDGIYSSRKTICLITRNYLKSNWCS 875

  Fly   933 LEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLD--EELKAYLKMNTYLKWGDPW-----FWDKLR 990
            .|.:.|.....:|.:..:|::...|| ...:|.  ..|:..:|..||::|..|.     ||.||:
Zfish   876 SEVQVASFRLFDEQKDVLILVFLEDI-PTHQLSPYHRLRKLVKKRTYIRWPKPGEDNKIFWQKLK 939

  Fly   991 FAL 993
            .||
Zfish   940 MAL 942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/59 (29%)
leucine-rich repeat 176..198 CDD:275380 4/22 (18%)
leucine-rich repeat 199..222 CDD:275380 6/23 (26%)
LRR_RI 216..542 CDD:238064 91/416 (22%)
LRR_8 221..281 CDD:290566 18/60 (30%)
leucine-rich repeat 223..270 CDD:275380 14/47 (30%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 8/89 (9%)
leucine-rich repeat 321..343 CDD:275380 3/22 (14%)
LRR_8 342..402 CDD:290566 23/85 (27%)
leucine-rich repeat 344..367 CDD:275380 10/40 (25%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 16/60 (27%)
leucine-rich repeat 392..415 CDD:275380 8/23 (35%)
leucine-rich repeat 416..439 CDD:275380 5/23 (22%)
leucine-rich repeat 440..474 CDD:275380 6/34 (18%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 17/58 (29%)
leucine-rich repeat 499..520 CDD:275380 8/21 (38%)
leucine-rich repeat 523..552 CDD:275380 8/33 (24%)
LRRCT 561..619 CDD:214507 8/58 (14%)
LRRNT 631..667 CDD:214470 7/36 (19%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 16/86 (19%)
leucine-rich repeat 694..715 CDD:275380 4/50 (8%)
leucine-rich repeat 716..737 CDD:275380 8/21 (38%)
LRRCT 751..800 CDD:214507 13/67 (19%)
TIR 858..996 CDD:214587 49/144 (34%)
tlr22NP_001122147.2 leucine-rich repeat 71..91 CDD:275380 5/27 (19%)
LRR_8 91..150 CDD:290566 18/59 (31%)
leucine-rich repeat 92..115 CDD:275380 6/23 (26%)
leucine-rich repeat 116..139 CDD:275380 9/23 (39%)
LRR_8 138..199 CDD:290566 13/72 (18%)
leucine-rich repeat 140..163 CDD:275380 5/23 (22%)
leucine-rich repeat 164..213 CDD:275380 7/60 (12%)
leucine-rich repeat 214..338 CDD:275380 21/124 (17%)
LRR_8 337..396 CDD:290566 20/60 (33%)
leucine-rich repeat 339..362 CDD:275380 8/23 (35%)
LRR_RI <363..494 CDD:238064 38/145 (26%)
leucine-rich repeat 363..385 CDD:275380 8/23 (35%)
LRR_8 384..444 CDD:290566 15/71 (21%)
leucine-rich repeat 386..409 CDD:275380 5/23 (22%)
leucine-rich repeat 410..433 CDD:275380 6/34 (18%)
LRR_8 432..492 CDD:290566 18/62 (29%)
leucine-rich repeat 434..457 CDD:275380 5/23 (22%)
leucine-rich repeat 458..481 CDD:275380 9/23 (39%)
LRR_RI 461..700 CDD:238064 62/309 (20%)
LRR_8 480..544 CDD:290566 23/122 (19%)
leucine-rich repeat 482..505 CDD:275380 8/34 (24%)
leucine-rich repeat 506..533 CDD:275380 9/55 (16%)
leucine-rich repeat 534..561 CDD:275380 10/58 (17%)
LRR_8 560..622 CDD:290566 10/62 (16%)
leucine-rich repeat 562..587 CDD:275380 5/25 (20%)
leucine-rich repeat 588..606 CDD:275380 2/18 (11%)
leucine-rich repeat 612..638 CDD:275380 2/26 (8%)
LRR_8 637..695 CDD:290566 13/58 (22%)
leucine-rich repeat 639..662 CDD:275380 10/23 (43%)
leucine-rich repeat 663..686 CDD:275380 1/23 (4%)
leucine-rich repeat 687..705 CDD:275380 5/18 (28%)
TIR 802..945 CDD:214587 49/144 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128590
orthoMCL 1 0.900 OOG5_134658
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.