DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr9

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001124066.1 Gene:tlr9 ZFINID:ZDB-GENE-040219-10 Length:1057 Species:Danio rerio

Alignment Length:1093 Identity:242/1094 (22%)
Similarity:394/1094 (36%) Gaps:347/1094 (32%)


  Fly   137 LGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRAN-----IEE--------- 187
            :.:|:...|:.|:.|                :..:.:.||.:|.|..|     ::|         
Zfish    59 ISLNLNNNHIHRIKG----------------DAFSGLPNLKYLSLMWNCISDRLKEARWPLCSVN 107

  Fly   188 MPSHLFDDLENLESIEFGSNKLRQMP-------------RGIFGKM-----PKLKQLNLWSN--- 231
            :....|..|:||.|::...|.|:.:|             ..||..:     |:||||.|..|   
Zfish   108 IDPDAFVGLKNLTSLQLAGNSLKMIPPLPKQLEVLGLEFNNIFNIVKPLGTPQLKQLLLSKNCFY 172

  Fly   232 -------------------QLHNLTKHDFEGAT--------SVLGIDIHDNGIEQLPHDVFAHLT 269
                               :|.|||. .:...|        |:..:|:.:|.|:.:..:.||:|.
Zfish   173 ANPCHQPYFINSSVFQDLPELLNLTL-SYNNLTAIPSYLPGSLESLDLRENTIDHINKESFANLR 236

  Fly   270 NVTDINLSANLFR-----------------SLPQGLF-DHNKHLNEVRLMNNRVPLATLPSRLFA 316
            |:..:||..|..|                 .|.|..| |....|..:.|..|  .|.|||..||.
Zfish   237 NLRHLNLGWNCQRCDHASDPCFPCPNNQSLDLHQDAFLDQRDSLVSLHLQGN--SLRTLPRHLFI 299

  Fly   317 NQPELQILRLRAELQSLP---GDLFEHSTQITNISLGDNL--LKTLP----ATLLEHQVNLLSLD 372
            |..:||.|.|.:...:..   |..:|....:..::|..|.  |||.|    :..:|...:|..|.
Zfish   300 NLHKLQELDLSSNFLAFTIQNGTFYEELQNVVILNLLYNYEPLKTFPELNLSPYIEKMASLRELY 364

  Fly   373 LS-------NNR----LTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRL 426
            ||       :||    |..||      ...:.|||:  |.:..||.|..|.|..|..:.:|:|.|
Zfish   365 LSGFFFKKLSNRSIAPLVKLP------RLEVLDLRM--NFICDISIDGLSQLRTLRRVDLSQNML 421

  Fly   427 RTIDSRAFVS-----TNGLRHL---HLDHNDIDLQQPLLDIM-LQTQINSP------FGYMH--- 473
                  ||.|     |:...|.   ...:...:||...|.|: .:||.:.|      |...|   
Zfish   422 ------AFSSCFSTCTSEAEHQIPERYGNEQFNLQMQELPILNAETQGSKPDYCSFYFSMWHFKR 480

  Fly   474 ----GLLTLNLRNNSIIFVYNDWKNT-----MLQLRELDLSYN------------NISSLGYEDL 517
                ..|..:|..|:|     .|.|.     |.::..:|||||            ::|.|.|.::
Zfish   481 QICSKSLYFDLSQNNI-----PWLNASTFRGMDRVACVDLSYNYISQTLNGHQFSHLSKLSYLNM 540

  Fly   518 AF----------------------LSQNRLHVNM----------THNKIRRIALPEDVHLGEGYN 550
            |:                      ||.|..|..|          ||.....|....:.|:|...:
Zfish   541 AYNRIDLYSDKAFQEVSGTLKALDLSNNEFHFIMKGMGHQFTFLTHMSSLIILSLANNHIGLRIS 605

  Fly   551 NNLVHVDL-----NDNPLVCDCTILW------FIQLVRGV----HKPQYSRQFKLRTDRLVCSQP 600
            |.|....|     :.|.|    .|||      :|.|.:|:    |......|.|..:..::.:.|
Zfish   606 NILTSASLKYLIFSGNRL----DILWDSWRNQYINLFQGLTNLTHLDISENQLKSLSPEVIVNLP 666

  Fly   601 NVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTY---------DKALVINCHSGNLT 656
            ..|:            :..:||               ::.||         .|...:|..|..|:
Zfish   667 LSLQ------------VLRVDF---------------NMLTYFPWANISVLQKLCYLNLSSNMLS 704

  Fly   657 HVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDI 721
            :   |||::..::|..|.|.:|.|:.:|........::.:|:|..|.|..:||..||... |...
Zfish   705 Y---LPNINFELRLTGLDLSHNRLVAIPKVFLSQAANLKNLNLNNNQLKILDVQALPLPF-HKGC 765

  Fly   722 SWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEM 786
            ::         :.|..::......:.|..||:.|.|.......|.::             .:.::
Zfish   766 TF---------IPGGQHKNRSSCKLVLHANPFTCSCVISGFAKFLRE-------------TDLDV 808

  Fly   787 PTRMVELSTNDICPAEKGVFIALAVVIALT----------GLLAGFTAALYYKFQTEIKIWLYAH 841
            |    .|:|...|    |...:||.|..|:          |.:|....:|.....|.:.:..:.:
Zfish   809 P----HLTTQVHC----GFPESLAGVNVLSVDLRSCQEIFGGVAFLCTSLLTLAATCVPLLKHLY 865

  Fly   842 NLLLWFVTE------------EDLDKDKKFDAFISYSHKDQSFIEDYLVPQL-----EHGPQKFQ 889
            ...||::.:            .....|.::|||:.:...::: :.|::..::     ..|..:||
Zfish   866 GWDLWYLIQILWTGHRGHTPANGNPTDTQYDAFVVFDTSNKA-VRDWIYKEMLVRLENRGRWRFQ 929

  Fly   890 LCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWA---RLEFRAAHRSALNEGRSRII 951
            ||:.||||:.|....||:.:||..||:|:.||:.....|:.:   |..|....:..|:| :..:.
Zfish   930 LCLEERDWIPGVSCIENLHKSVYSSRKTVFVLTSPGGYSDASGIVRQAFLLVQQRLLDE-KVDVA 993

  Fly   952 VIIYSDIGDVEKLDEELKAYLKM------NTYLKWG-----DPWFWDKLRFAL 993
            |::..|.     |..:.| ||:|      .:.|.|.     .|.||:.||.||
Zfish   994 VLVLLDF-----LFPKFK-YLQMRKRLCKKSVLSWPRNPRVQPLFWNDLRVAL 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 23/113 (20%)
leucine-rich repeat 176..198 CDD:275380 7/36 (19%)
leucine-rich repeat 199..222 CDD:275380 8/41 (20%)
LRR_RI 216..542 CDD:238064 113/470 (24%)
LRR_8 221..281 CDD:290566 23/90 (26%)
leucine-rich repeat 223..270 CDD:275380 18/77 (23%)
leucine-rich repeat 271..294 CDD:275380 8/41 (20%)
leucine-rich repeat 295..320 CDD:275380 10/25 (40%)
leucine-rich repeat 321..343 CDD:275380 6/25 (24%)
LRR_8 342..402 CDD:290566 20/77 (26%)
leucine-rich repeat 344..367 CDD:275380 7/29 (24%)
leucine-rich repeat 368..391 CDD:275380 9/34 (26%)
LRR_8 390..450 CDD:290566 18/68 (26%)
leucine-rich repeat 392..415 CDD:275380 9/23 (39%)
leucine-rich repeat 416..439 CDD:275380 8/28 (29%)
leucine-rich repeat 440..474 CDD:275380 10/51 (20%)
leucine-rich repeat 475..498 CDD:275380 7/28 (25%)
LRR_8 477..534 CDD:290566 22/106 (21%)
leucine-rich repeat 499..520 CDD:275380 9/55 (16%)
leucine-rich repeat 523..552 CDD:275380 9/39 (23%)
LRRCT 561..619 CDD:214507 13/68 (19%)
LRRNT 631..667 CDD:214470 9/45 (20%)
leucine-rich repeat 664..693 CDD:275380 6/29 (21%)
LRR_8 669..726 CDD:290566 15/57 (26%)
leucine-rich repeat 694..715 CDD:275380 8/21 (38%)
leucine-rich repeat 716..737 CDD:275380 2/21 (10%)
LRRCT 751..800 CDD:214507 9/49 (18%)
TIR 858..996 CDD:214587 44/156 (28%)
tlr9NP_001124066.1 leucine-rich repeat 39..57 CDD:275380
LRR_8 56..129 CDD:290566 16/86 (19%)
leucine-rich repeat 58..81 CDD:275380 4/38 (11%)
LRR_RI <73..312 CDD:238064 59/258 (23%)
leucine-rich repeat 82..118 CDD:275380 7/36 (19%)
leucine-rich repeat 119..138 CDD:275380 5/19 (26%)
leucine-rich repeat 139..192 CDD:275380 9/53 (17%)
LRR_8 191..246 CDD:290566 15/56 (27%)
leucine-rich repeat 193..213 CDD:275380 5/21 (24%)
leucine-rich repeat 214..237 CDD:275380 6/23 (26%)
leucine-rich repeat 238..279 CDD:275380 8/41 (20%)
LRR_RI 274..>422 CDD:238064 46/164 (28%)
leucine-rich repeat 280..303 CDD:275380 10/25 (40%)
leucine-rich repeat 304..323 CDD:275380 5/19 (26%)
leucine-rich repeat 360..386 CDD:275380 9/32 (28%)
leucine-rich repeat 387..408 CDD:275380 8/23 (35%)
LRR_8 490..545 CDD:290566 15/60 (25%)
leucine-rich repeat 490..509 CDD:275380 6/24 (25%)
leucine-rich repeat 510..534 CDD:275380 6/24 (25%)
leucine-rich repeat 535..559 CDD:275380 3/24 (13%)
leucine-rich repeat 560..589 CDD:275380 7/29 (24%)
leucine-rich repeat 590..612 CDD:275380 5/22 (23%)
LRR_8 612..679 CDD:290566 16/98 (16%)
leucine-rich repeat 613..643 CDD:275380 9/34 (26%)
leucine-rich repeat 644..668 CDD:275380 4/24 (17%)
leucine-rich repeat 669..692 CDD:275380 5/50 (10%)
leucine-rich repeat 693..714 CDD:275380 6/24 (25%)
TIR_2 894..1040 CDD:304906 43/154 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.