DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr3

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001013287.2 Gene:tlr3 ZFINID:ZDB-GENE-040219-7 Length:903 Species:Danio rerio

Alignment Length:959 Identity:215/960 (22%)
Similarity:374/960 (39%) Gaps:240/960 (25%)


  Fly   163 THIPANLLTDMRNLSHLELRANIEEMPS-HLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQL 226
            |.:|.|:.|  .::||..|:.    :.| |::.:|.|:::   ..|.|..:.:.:...:|.|:.|
Zfish    50 TDLPTNITT--LDVSHNRLKT----LSSLHMYTNLVNIDA---SYNSLAGIEKDLCLSLPHLQFL 105

  Fly   227 NLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDH 291
            |:..||::.:::.:.:....:..:|:.||.: :|..:.|:.|.|:|.:::|.|...|...|....
Zfish   106 NVQHNQVYLISEKNLKNCFHLTQLDLSDNKL-KLQGEPFSLLKNLTWLDVSRNKLTSAKLGTEPQ 169

  Fly   292 NKHLNEVRLMNNRVPLATLPSRLF-ANQPELQILRLRA---------------ELQSLPGD---- 336
            ..:|..:.|..|.:.:.......| :|....::|.|.:               .|..|..|    
Zfish   170 LPNLVTLVLSGNNINILQENDFSFLSNSSSFRVLILSSLILKKVENGCFKAIDTLSDLVLDSSKL 234

  Fly   337 -------LFEH--STQITNISLGDNLLKTLPATLLE--HQVNLLSLDLSNNRLTHLPDSLFAHTT 390
                   |||.  .|.:.|:||......||..|..:  .:..:..||||.||::.:.|..|....
Zfish   235 TSQFTTSLFEELADTALRNLSLKSTEQVTLSNTTFQGLEKTKITVLDLSENRISKIVDGAFQWLP 299

  Fly   391 NLTDLRLEDNLLTGISGDIFSNLGNL------VTLVMSRNRLRTIDSRAF-----------VST- 437
            .|..|.||.|.:..::.|.||.||||      ..|:.|...|..||..:|           .:| 
Zfish   300 QLEFLSLEHNTIRHLTNDSFSGLGNLRQLNLRKALIKSHASLPVIDDFSFQHLVQLEYLCMANTA 364

  Fly   438 ---------NGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHG---LLTLNLRNNSIIFVYN 490
                     :|||:|    ..:||...:..|  :|..|..|..:..   |.||||          
Zfish   365 FRELTEQIFSGLRNL----KTLDLSWSITGI--KTVTNKTFAGLQESPLLQTLNL---------- 413

  Fly   491 DWKNTMLQLRELD----LSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNN 551
                |.:.:.:|:    .|..|:|:|      .:|:|.::..:..|:.:.:             :
Zfish   414 ----TGMGINKLEPGAFSSLGNLSNL------LMSRNFINQQLQGNEFKGL-------------S 455

  Fly   552 NLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTL 616
            |:..:|::.|......|...|:.:            ..|||.:|    ...|:||          
Zfish   456 NIKEIDMSINQQSISLTNASFVHV------------STLRTLKL----GRALKGT---------- 494

  Fly   617 ICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLME-------LH 674
               ||....|            .|......:::..:.|:.::        |..|:|       :.
Zfish   495 ---LDMEPSP------------FRPLVNLTILDLSNNNIANI--------NADLLEGLYNLKVVK 536

  Fly   675 LENNTLLRLPSANTPG-----YESVTSLHLAGNNLTSIDVDQLPTN-------LTHLDISWNHLQ 727
            :::|.|.||.....||     .:..|:|...  ||....:|::|.|       |..|.:..|.|.
Zfish   537 MQHNNLARLWKMANPGGPVLFLKDATNLSYL--NLDYNGIDEIPPNAFRGFSELHELSLRGNLLD 599

  Fly   728 MLNATVLGFLNR----------------------TMKWRSVKLSGNPWMCDCTAKPLLLFTQ--- 767
            .|:|:|...||.                      ..|.:.:.:..||:  |||.:.:|.|::   
Zfish   600 QLHASVFDDLNSLKYLHLQKNLITSVQRATFGVPLSKLKELNMDHNPF--DCTCESILWFSEWLN 662

  Fly   768 -DNFERIGDRNEMMC--VNAEMPTRMVE---LSTNDICPAEKGVFIALAVVIALTGLLAGFTAAL 826
             .|....|.....:|  .||.....::.   ||..|:.|     |.||.::.:...|:..|.:.|
Zfish   663 STNTSVPGFPQSYICNTPNAYFNHSVMNFDPLSCKDMTP-----FKALYILSSTAVLMLLFISFL 722

  Fly   827 YYKFQTEIKI-WLYAHNLLLWFVTEEDLDKDK-KFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQ 889
            .:.....|:. |....|.:|..:.:..:.:.: :|||:|.::.:|:|::|..|: .||.....| 
Zfish   723 VHFQGWRIQFYWNIMVNRMLGSLKDAKVTEGRFQFDAYIIHAGEDKSWVERSLL-SLEDKDLNF- 785

  Fly   890 LCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAH--RSALNEGRSRIIV 952
             ...:||...|....|.|:.::..||:.|.|:::..:|..|.| :|:|.|  ...:.:.|..:|:
Zfish   786 -FYEQRDSTPGHSRLETIVDNMVYSRKIIFVITEMLLKDPWCR-QFKAHHALHHVMEDNRDSLIL 848

  Fly   953 IIYSDIGDVEKLDEEL---KAYLKMNTYLKW-----GDPWFWDKLRFAL 993
            |...|:.|. .|:..|   :..||....|.|     ..|.|..|||.||
Zfish   849 IFLEDVTDY-NLNRSLHLRRGMLKPKCVLYWPLHKERIPAFHQKLRSAL 896

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 15/60 (25%)
leucine-rich repeat 176..198 CDD:275380 6/23 (26%)
leucine-rich repeat 199..222 CDD:275380 3/23 (13%)
LRR_RI 216..542 CDD:238064 89/391 (23%)
LRR_8 221..281 CDD:290566 16/60 (27%)
leucine-rich repeat 223..270 CDD:275380 11/47 (23%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 5/26 (19%)
leucine-rich repeat 321..343 CDD:275380 9/50 (18%)
LRR_8 342..402 CDD:290566 20/62 (32%)
leucine-rich repeat 344..367 CDD:275380 6/25 (24%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 23/87 (26%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 8/50 (16%)
leucine-rich repeat 440..474 CDD:275380 9/34 (26%)
leucine-rich repeat 475..498 CDD:275380 6/23 (26%)
LRR_8 477..534 CDD:290566 13/61 (21%)
leucine-rich repeat 499..520 CDD:275380 5/25 (20%)
leucine-rich repeat 523..552 CDD:275380 2/29 (7%)
LRRCT 561..619 CDD:214507 10/58 (17%)
LRRNT 631..667 CDD:214470 2/36 (6%)
leucine-rich repeat 664..693 CDD:275380 9/41 (22%)
LRR_8 669..726 CDD:290566 18/76 (24%)
leucine-rich repeat 694..715 CDD:275380 6/21 (29%)
leucine-rich repeat 716..737 CDD:275380 7/21 (33%)
LRRCT 751..800 CDD:214507 15/58 (26%)
TIR 858..996 CDD:214587 44/147 (30%)
tlr3NP_001013287.2 LRR_RI <49..183 CDD:238064 34/143 (24%)
leucine-rich repeat 57..77 CDD:275380 6/26 (23%)
leucine-rich repeat 78..101 CDD:275380 5/26 (19%)
leucine-rich repeat 102..125 CDD:275380 5/23 (22%)
LRR_8 125..183 CDD:290566 15/59 (25%)
leucine-rich repeat 126..148 CDD:275380 6/23 (26%)
leucine-rich repeat 149..172 CDD:275380 5/23 (22%)
leucine-rich repeat 173..276 CDD:275380 20/103 (19%)
LRR_8 275..331 CDD:290566 20/56 (36%)
leucine-rich repeat 278..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..324 CDD:275380 10/23 (43%)
leucine-rich repeat 325..354 CDD:275380 7/29 (24%)
leucine-rich repeat 355..378 CDD:275380 4/23 (17%)
leucine-rich repeat 379..404 CDD:275380 7/31 (23%)
LRR_8 406..466 CDD:290566 17/93 (18%)
leucine-rich repeat 408..431 CDD:275380 8/37 (22%)
leucine-rich repeat 432..456 CDD:275380 5/43 (12%)
leucine-rich repeat 457..507 CDD:275380 15/91 (16%)
leucine-rich repeat 482..498 CDD:275380 9/33 (27%)
leucine-rich repeat 508..531 CDD:275380 4/31 (13%)
leucine-rich repeat 532..563 CDD:275380 7/31 (23%)
LRR_8 562..622 CDD:290566 16/62 (26%)
leucine-rich repeat 564..587 CDD:275380 6/25 (24%)
leucine-rich repeat 588..611 CDD:275380 9/23 (39%)
leucine-rich repeat 612..630 CDD:275380 0/18 (0%)
LRRCT 645..>683 CDD:214507 12/40 (30%)
TIR 756..898 CDD:214587 44/147 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.