DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr21

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001186264.1 Gene:tlr21 ZFINID:ZDB-GENE-040220-4 Length:989 Species:Danio rerio

Alignment Length:1066 Identity:265/1067 (25%)
Similarity:409/1067 (38%) Gaps:293/1067 (27%)


  Fly   105 RRCM-LP--GHTPIASILDY----LGIVS---PTTLIFESDNLGMN------ITRQHLDRLHGLK 153
            |.|: :|  .||....:..|    ..|||   ||.|     ||.::      :..|..|.|..|.
Zfish    28 RSCIEIPDSNHTIFTCVKSYERDITAIVSDVFPTAL-----NLTISHSNIEYVQSQSFDHLPNLT 87

  Fly   154 RFRFTTRRLTHIPANLLTDMRNLSHLELRA-NIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIF 217
            ........:|:|..:...::.:|..|.|.. ||..:...:|.||.||..:..|||||....:.:|
Zfish    88 ALILDANHITNIDKDAFNNLHHLQTLNLSCNNISFLHRDVFSDLHNLTQLLLGSNKLTNPDKYLF 152

  Fly   218 GKMPKLKQLNLWSNQLHNLTK--HDFEGATSVLGIDIHDNGIEQLPHDVF--------------- 265
            ..:..||.|:|..|.|:|.:.  ......||::.:|:..|.:..|.|...               
Zfish   153 SSLTNLKILDLRRNHLYNFSSVVESITNLTSLIKLDLSFNKLTTLQHSTHLPESLALLYLGDNKL 217

  Fly   266 -------AHLTNVTDINLSAN---------------------------LFRSLP----------- 285
                   :.|.||..::||.|                           :|:.|.           
Zfish   218 KTLGCDKSFLMNVKKLDLSDNKNLASKSFLGLKLENITYLRLRFTNISIFKLLTYPNVHPWHIDF 282

  Fly   286 QGLFDHNKH-LNEV-RLMNNRVPLATLPSRLFANQPELQILRLRAELQS---LPGDLFEHSTQIT 345
            .||...|.| |:.: .||.|.            :...|||.::..:..|   |..:.|.:...||
Zfish   283 SGLKLKNSHALSSLCVLMRNH------------SHKHLQIPKMLLQSNSIGALKNNTFRYCPSIT 335

  Fly   346 -NISLGDNLLKTLPA-TLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTN-LTDLRLEDNLLTGISG 407
             .:.|..|.||:... ..|.:|..|.||.:.:|.||.|.....|...| ||:|....|.:..|||
Zfish   336 REMDLSRNELKSAGCLQFLHNQTQLKSLKMEHNHLTKLTSCNKAEIHNSLTNLSYRYNRILQISG 400

  Fly   408 DIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYM 472
            ..|||...|..|.::.|.:..:|.:|......|:.|.||:|           :|....|..|..:
Zfish   401 YAFSNTPKLEILELNINIIAYMDHKALSGLKDLKTLRLDNN-----------LLSDIYNDSFEDL 454

  Fly   473 HGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSL------GYEDLAFLSQNRLHVNMTH 531
            ..|.|||||||.|..::|.....:.:|..|||..|.||.|      |...|..|..:|.|:.|. 
Zfish   455 TNLKTLNLRNNEIAVIFNYTFQNLSKLDILDLGGNKISQLKPHAFDGLYSLTNLYLDRNHLKMI- 518

  Fly   532 NKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKP--QYSRQFKLRTDR 594
                      ||.|....:..|..:||..|      .|::|.:   ..|.|  ..||.:.|   :
Zfish   519 ----------DVVLFGKLSGTLQVLDLQGN------MIMYFTE---HTHSPFKNMSRLYDL---K 561

  Fly   595 LVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHV-----RTYD--KALVINCHS 652
            |...|||.:...|.......|.:..|..:            |.|:     .|:|  |.|......
Zfish   562 LNGQQPNGINLLPRAFFRGLTSLKSLYLT------------NNHIIGFGDETFDDLKNLDYLTLD 614

  Fly   653 GNLTHVPRLPN-LHKNMQ-LMELHLENNTLLRLPSANTPGYESVT---SLHLAGNNLTSIDVDQL 712
            .:...|.:|.: :.|::| |..|.|||   :.:.|.:...:.::|   :|||..|.:.|:|:..|
Zfish   615 NSCAGVAQLQSGIFKSLQKLRTLSLEN---MGIKSFSKDVFGNLTGLKTLHLNRNPMMSLDISLL 676

  Fly   713 P--TNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGD 775
            .  |||.::|:                      ||..||     |.|....|..:|         
Zfish   677 DNLTNLIYIDM----------------------RSCPLS-----CGCHNSDLQNWT--------- 705

  Fly   776 RNEMMCVNAEMPTRMVELSTNDICPAEKGVFI---------------------ALAVVIALTGLL 819
               :|....:.|...     |..||...|.:.                     .|.:::.|..||
Zfish   706 ---IMNKRLQFPHLF-----NITCPDHPGSYFHNFDTKVCYLDIELYFFSSTSTLTILLTLIPLL 762

  Fly   820 AGFTAALYYKFQTEIKIWLYAHNLL-LWFVTE----EDLDKDKKFDAFISYSHKDQSFIEDYLVP 879
               ...||:||:       |.:.:. .||..:    .|.::...:|||:||:..|:.::.:.|:|
Zfish   763 ---YVKLYWKFK-------YGYYVFRSWFGEQWRRLRDQEEKYNYDAFVSYNSADEDWVMEQLLP 817

  Fly   880 QLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALN 944
            .||  ...|:||:|.||:.:|..|.:||:.:|..||:||.|:||:|::|||..||.:.|......
Zfish   818 NLE--GSSFRLCLHHRDFELGRDIVDNIVAAVYGSRKTICVVSQSFLRSEWCSLEIQLASYRLFQ 880

  Fly   945 EGRSRIIVIIYSDIGDVEKLDEELKAYLKM------NTYLKW-----GDP-----WFWDKLRFAL 993
            |.:..::::....|.     :.:|.||.:|      .|||:|     .||     .||::|:.||
Zfish   881 EMQDVLLLVFLEPIP-----ERQLSAYHRMRKVMLKKTYLQWPGSNCSDPNSAKELFWNQLKRAL 940

  Fly   994 PHRRPVGNIGNGALIKTALKGSTDDK 1019
                           :::..||.|::
Zfish   941 ---------------RSSNSGSQDEQ 951

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 21/60 (35%)
leucine-rich repeat 176..198 CDD:275380 8/23 (35%)
leucine-rich repeat 199..222 CDD:275380 7/23 (30%)
LRR_RI 216..542 CDD:238064 100/402 (25%)
LRR_8 221..281 CDD:290566 19/111 (17%)
leucine-rich repeat 223..270 CDD:275380 14/71 (20%)
leucine-rich repeat 271..294 CDD:275380 9/61 (15%)
leucine-rich repeat 295..320 CDD:275380 4/26 (15%)
leucine-rich repeat 321..343 CDD:275380 6/25 (24%)
LRR_8 342..402 CDD:290566 21/63 (33%)
leucine-rich repeat 344..367 CDD:275380 8/25 (32%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 21/61 (34%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 5/23 (22%)
leucine-rich repeat 440..474 CDD:275380 8/34 (24%)
leucine-rich repeat 475..498 CDD:275380 10/23 (43%)
LRR_8 477..534 CDD:290566 23/63 (37%)
leucine-rich repeat 499..520 CDD:275380 10/27 (37%)
leucine-rich repeat 523..552 CDD:275380 6/29 (21%)
LRRCT 561..619 CDD:214507 14/60 (23%)
LRRNT 631..667 CDD:214470 9/44 (20%)
leucine-rich repeat 664..693 CDD:275380 8/30 (27%)
LRR_8 669..726 CDD:290566 19/63 (30%)
leucine-rich repeat 694..715 CDD:275380 9/26 (35%)
leucine-rich repeat 716..737 CDD:275380 2/21 (10%)
LRRCT 751..800 CDD:214507 8/49 (16%)
TIR 858..996 CDD:214587 52/154 (34%)
tlr21NP_001186264.1 leucine-rich repeat 65..85 CDD:275380 4/20 (20%)
LRR_8 84..144 CDD:290566 17/60 (28%)
leucine-rich repeat 86..109 CDD:275380 3/23 (13%)
LRR_RI 107..350 CDD:238064 57/255 (22%)
leucine-rich repeat 110..133 CDD:275380 8/23 (35%)
leucine-rich repeat 134..157 CDD:275380 7/23 (30%)
LRR_8 156..217 CDD:290566 13/61 (21%)
leucine-rich repeat 158..183 CDD:275380 8/25 (32%)
leucine-rich repeat 184..206 CDD:275380 4/22 (18%)
leucine-rich repeat 207..229 CDD:275380 1/22 (5%)
leucine-rich repeat 230..253 CDD:275380 4/23 (17%)
LRR_RI <336..540 CDD:238064 69/232 (30%)
leucine-rich repeat 360..383 CDD:275380 8/23 (35%)
leucine-rich repeat 385..408 CDD:275380 10/23 (43%)
LRR_8 407..467 CDD:290566 21/71 (30%)
leucine-rich repeat 409..432 CDD:275380 5/23 (22%)
leucine-rich repeat 433..456 CDD:275380 8/34 (24%)
LRR_8 455..515 CDD:290566 23/60 (38%)
leucine-rich repeat 457..480 CDD:275380 10/23 (43%)
leucine-rich repeat 481..504 CDD:275380 9/23 (39%)
leucine-rich repeat 505..529 CDD:275380 8/35 (23%)
leucine-rich repeat 530..556 CDD:275380 9/35 (26%)
LRR_8 555..615 CDD:290566 16/75 (21%)
leucine-rich repeat 557..583 CDD:275380 7/29 (24%)
LRR_8 582..668 CDD:290566 23/101 (23%)
leucine-rich repeat 584..607 CDD:275380 6/35 (17%)
leucine-rich repeat 608..633 CDD:275380 5/25 (20%)
leucine-rich repeat 634..657 CDD:275380 7/26 (27%)
leucine-rich repeat 658..679 CDD:275380 7/21 (33%)
leucine-rich repeat 682..694 CDD:275378 6/39 (15%)
TIR 797..942 CDD:214587 52/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128590
orthoMCL 1 0.900 OOG5_134658
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8923
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.