DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Toll-7

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster

Alignment Length:1418 Identity:330/1419 (23%)
Similarity:515/1419 (36%) Gaps:423/1419 (30%)


  Fly    10 LALLVIILQLLQW----------PGSEAS------FGRDACSEMSIDG----LCQCAPIMSEYEI 54
            :|.::::|....|          ..||:|      .|..|.:.:|:.|    |....|..|.   
  Fly     1 MAAILLLLLGFSWSLAVESALAPKESESSASAMLGAGTGAAATVSLSGDYSSLLSNVPAASP--- 62

  Fly    55 ICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCML------PGHT 113
             .|||...|:     .|.:......|.|.:.                    .|.|      ||  
  Fly    63 -VPANPSQPS-----GPANQCSWSYNGTSSV--------------------HCALRLIERQPG-- 99

  Fly   114 PIASILDYLGIVSPTTLIFESDNLGM---NITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRN 175
                 ||..|....:.|..:...|.:   .:......||..|:..|..:.:|..:|.|....:..
  Fly   100 -----LDLQGADGSSQLTIQCSELYLFESTLPVAVFARLQTLEALRLDSCKLLQLPNNAFEGLAT 159

  Fly   176 LSHLELRA-NIEEMPS---HLFDD----LENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQ 232
            |..|.|.. |.|..|:   .||.|    |:.|..::.|.|.|||:|.|....:..|:.|||..|:
  Fly   160 LKSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNR 224

  Fly   233 LHNLTKHDFE----GATS--------VLG-----------------------IDIHDNGIEQLPH 262
            :....:..|.    ||.|        ||.                       :::..|.:.:|..
  Fly   225 IRTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSG 289

  Fly   263 DVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLF------------ 315
            :..|.|.::..:|||.|...:||:|||..:|.|.|:.|..|.  |..||..||            
  Fly   290 EALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNE--LYELPKGLFHRLEQLLVVDLS 352

  Fly   316 -----ANQPE---------------------------------LQILRLR--------------- 327
                 :|..:                                 ||||.||               
  Fly   353 GNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPL 417

  Fly   328 --------AE--LQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLP 382
                    ||  |.:|...||.....::.::|.:||:..:...:.::..:|..||||:|:|..:|
  Fly   418 YNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVP 482

  Fly   383 DSL-----------------------FAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRN 424
            .:|                       |.:...||.|||.||.:..|:..:|.:|..|..|.:::|
  Fly   483 RALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKN 547

  Fly   425 RLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVY 489
            |:::|:..:|.....|..:.||.|.:            ..||..|..:..||.|||..|.:  |:
  Fly   548 RIQSIERGSFDKNFELEAIRLDRNFL------------ADINGVFATLVSLLWLNLSENHL--VW 598

  Fly   490 NDWKNTMLQLRELDLSYNNISSLG-YEDLAFLSQNRLHV---NMTHNKIRRI---ALPEDVHLGE 547
            .|:......|:.||:..|.|.:|| |..|    |..:.|   :.:||:|..|   ::|..:.|..
  Fly   599 FDYAFIPSNLKWLDIHGNYIEALGNYYKL----QEEIRVKTLDASHNRITEIGPMSIPNTIELLF 659

  Fly   548 GYNN--------------NLVHVD-----------------------------LNDNPLVCDCTI 569
            ..||              ||..||                             |..||..||||:
  Fly   660 INNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFECDCTM 724

  Fly   570 LWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQ---IEPQTLICP-----------L 620
            .| :|.:..:...|:.|...:.  .:.|..|:. .|..||.   :.||..:|.           .
  Fly   725 DW-LQRINNLTTRQHPRVMDMA--NIECVMPHA-RGAAVRPLSGLRPQDFLCRYESHCFALCHCC 785

  Fly   621 DFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR---------------LPNL------ 664
            ||.....|..||..|.|:........|::|.....|.:||               .|.|      
  Fly   786 DFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNNFPVLKNHAFI 850

  Fly   665 -HKNMQ----------------------LMELHLENNTLLRLPSANTPGYE-----SVTSLHLAG 701
             .||::                      |..|||.:|.|..|     .|||     ::..|:|..
  Fly   851 GRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTL-----HGYEFEQLSALRELYLQN 910

  Fly   702 NNLTSIDVDQLP--TNLTHLDISWNHLQML-----NATVLGFLNRTMKWRSVKLSGNPWMCDCT- 758
            |.||:|:...|.  ..|..:.|..|.|..|     :||..|     .:.:|:.|..|.|.|.|. 
  Fly   911 NQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFG-----TRLKSISLGRNQWSCRCQF 970

  Fly   759 AKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVEL------------------STNDICP----- 800
            .:.|..:..||...:.|..::.|:.|...|....|                  :|...|.     
  Fly   971 LQALTSYVADNALIVQDAQDIYCMAASSGTGSAALEDSSSNSGSLEKRELDFNATGAACTDYYSG 1035

  Fly   801 ---AEKGV---FI-ALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKK 858
               .:.|:   :| .||..:||..||.  ..|:.:.|:..::|||:||..:..|....: :.:|.
  Fly  1036 GSMLQHGIPESYIPLLAAALALLFLLV--VIAMVFAFRESLRIWLFAHYGVRVFGPRCE-ESEKL 1097

  Fly   859 FDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQ 923
            :||.:.:|.||..|:..:|..|||.|....::|:..|| |........::.:...|||.:|:|::
  Fly  1098 YDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRD-LAHDATHYQLLEATRVSRRVVILLTR 1161

  Fly   924 NFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTY--LKWGDPWFW 986
            ||:::||||.|.|.:...||.....::::|...::....:.|.||..|||.:..  ::..|..||
  Fly  1162 NFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEAESDIELLPYLKTSAVHRIRRSDRHFW 1226

  Fly   987 DKLRFALPHRRPVGNIGNGALIKTALKGSTDDKLE-------LIKPSPVTPPLTTPPAEATKNPL 1044
            :|||:|||...|... ||...::  |.....::::       |.:.:|  ||....||:|.....
  Fly  1227 EKLRYALPVDYPTFR-GNNYTLE--LDHHNHERVKQPASPGLLYRQAP--PPAYCGPADAVGIGA 1286

  Fly  1045 VAQLNGVTPHQAIMIANGKNGLTNLYTPNGK-----------SHGNGHINGAF 1086
            |.|   |.|..|.:.|..........||:.:           |.||.|::..:
  Fly  1287 VPQ---VVPVNASVPAEQNYSTATTATPSPRPQRRGEQPGSGSGGNHHLHAQY 1336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 23/67 (34%)
leucine-rich repeat 176..198 CDD:275380 10/30 (33%)
leucine-rich repeat 199..222 CDD:275380 8/23 (35%)
LRR_RI 216..542 CDD:238064 107/466 (23%)
LRR_8 221..281 CDD:290566 19/95 (20%)
leucine-rich repeat 223..270 CDD:275380 15/82 (18%)
leucine-rich repeat 271..294 CDD:275380 10/23 (43%)
leucine-rich repeat 295..320 CDD:275380 10/42 (24%)
leucine-rich repeat 321..343 CDD:275380 12/47 (26%)
LRR_8 342..402 CDD:290566 20/83 (24%)
leucine-rich repeat 344..367 CDD:275380 3/23 (13%)
leucine-rich repeat 368..391 CDD:275380 10/46 (22%)
LRR_8 390..450 CDD:290566 20/60 (33%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 7/34 (21%)
leucine-rich repeat 475..498 CDD:275380 8/23 (35%)
LRR_8 477..534 CDD:290566 19/61 (31%)
leucine-rich repeat 499..520 CDD:275380 9/22 (41%)
leucine-rich repeat 523..552 CDD:275380 9/49 (18%)
LRRCT 561..619 CDD:214507 18/61 (30%)
LRRNT 631..667 CDD:214470 12/58 (21%)
leucine-rich repeat 664..693 CDD:275380 13/63 (21%)
LRR_8 669..726 CDD:290566 20/86 (23%)
leucine-rich repeat 694..715 CDD:275380 7/23 (30%)
leucine-rich repeat 716..737 CDD:275380 8/26 (31%)
LRRCT 751..800 CDD:214507 14/68 (21%)
TIR 858..996 CDD:214587 46/140 (33%)
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 18/66 (27%)
leucine-rich repeat 136..159 CDD:275380 5/23 (22%)
leucine-rich repeat 160..190 CDD:275380 10/30 (33%)
LRR_8 189..259 CDD:290566 19/70 (27%)
leucine-rich repeat 191..214 CDD:275380 8/23 (35%)
leucine-rich repeat 215..248 CDD:275380 9/33 (27%)
LRR_RI 247..501 CDD:238064 50/256 (20%)
LRR_8 247..308 CDD:290566 10/61 (16%)
leucine-rich repeat 249..273 CDD:275380 2/24 (8%)
leucine-rich repeat 274..297 CDD:275380 4/23 (17%)
LRR_8 297..356 CDD:290566 19/61 (31%)
leucine-rich repeat 298..321 CDD:275380 10/23 (43%)
leucine-rich repeat 322..345 CDD:275380 9/25 (36%)
LRR_8 345..406 CDD:290566 7/61 (11%)
leucine-rich repeat 346..371 CDD:275380 1/25 (4%)
leucine-rich repeat 372..395 CDD:275380 0/23 (0%)
leucine-rich repeat 396..419 CDD:275380 6/23 (26%)
LRR_8 419..478 CDD:290566 15/59 (25%)
leucine-rich repeat 420..443 CDD:275380 6/23 (26%)
leucine-rich repeat 444..467 CDD:275380 3/23 (13%)
LRR_RI 466..622 CDD:238064 47/170 (28%)
leucine-rich repeat 468..488 CDD:275380 9/20 (45%)
LRR_8 491..549 CDD:290566 15/58 (26%)
leucine-rich repeat 491..514 CDD:275380 1/23 (4%)
leucine-rich repeat 515..536 CDD:275380 9/21 (43%)
leucine-rich repeat 539..562 CDD:275380 6/23 (26%)
leucine-rich repeat 563..585 CDD:275380 7/34 (21%)
leucine-rich repeat 586..626 CDD:275380 16/42 (38%)
leucine-rich repeat 627..653 CDD:275380 8/30 (27%)
LRRCT 716..772 CDD:214507 17/60 (28%)
LRRNT 796..830 CDD:214470 9/34 (26%)
leucine-rich repeat 812..829 CDD:275380 5/17 (29%)
leucine-rich repeat 833..854 CDD:275380 3/21 (14%)
LRR_8 853..913 CDD:290566 15/65 (23%)
leucine-rich repeat 855..878 CDD:275380 0/23 (0%)
LRR_4 878..918 CDD:289563 16/45 (36%)
leucine-rich repeat 879..902 CDD:275380 10/28 (36%)
leucine-rich repeat 903..926 CDD:275380 7/23 (30%)
leucine-rich repeat 927..953 CDD:275380 8/31 (26%)
TIR 1098..1235 CDD:214587 46/138 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19499423
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.