DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr3

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_942086.1 Gene:Tlr3 RGDID:735171 Length:905 Species:Rattus norvegicus

Alignment Length:1003 Identity:245/1004 (24%)
Similarity:396/1004 (39%) Gaps:234/1004 (23%)


  Fly   118 ILDYLGIVSPTTLIFESDN---LGMNITR-QHLDRLHGLKRFRFTTRRLTHIPANLLTDMR--NL 176
            |..:.|::|...|:..|.|   :..|:.. .||              :|||||.:|.:::.  ||
  Rat     9 IYSFGGLLSLWILVVSSTNQCTVRYNVADCSHL--------------KLTHIPDDLPSNITVLNL 59

  Fly   177 SHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDF 241
            :|.:||.    :|...|.....|..::.|.|.:.::...:...:|.||.|||..|:|..::...|
  Rat    60 THNQLRG----LPPANFTRYSQLALLDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTF 120

  Fly   242 EGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVP 306
            ...|::..:.:..|.|.::..:.|.:..::..::||.|...|...|.:...::|.|:.|..|:: 
  Rat   121 AFCTNLTELHLMSNSIRKIKSNPFKNQKSLIKLDLSHNGLSSTKLGTWVQLENLQELLLAKNKI- 184

  Fly   307 LATLPSRLFA-NQPELQILRLRAELQSL-----------PG--------------------DLFE 339
                    || ...||..|. .:.||.|           ||                    ||.|
  Rat   185 --------FALRNEELDFLG-NSSLQKLDLSSNPLKEFSPGCFHAIGKLFVLLLNNAQLNLDLTE 240

  Fly   340 ------HSTQITNISLGDN-LLKTLPATLLE-HQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLR 396
                  .:|.|.|:||.:| ||.|..:|... .|.||.|||||.|.|..:.:..|:...:|..|.
  Rat   241 KLCWELSNTSIQNLSLANNQLLATSNSTFSGLKQTNLTSLDLSYNSLRDVGNDAFSWLPHLKYLS 305

  Fly   397 LEDNLLTGISGDIFSNLGNLVTLVMSRNRLR---------TIDSRAFVSTNGLRHLHLDHNDID- 451
            ||.|.:..::...|..|.||..|.:.|...:         .||..:|.....|.||::|.|.|. 
  Rat   306 LEYNNIQRLTPHSFRGLSNLRYLSLKRAFTKQSVALASHPNIDDFSFQWLKCLEHLNMDDNTIPG 370

  Fly   452 ---------LQQPLLDIM-----LQTQINSPF-GYMHG-LLTLNLRNNSIIFVYNDWKNTMLQLR 500
                     :....|.:.     |||..|..| ...|. ||||||..|.|..:.:...:.:.|||
  Rat   371 IKSNTFTGLVSLKYLSLSKTFTGLQTLTNETFVSLTHSPLLTLNLTKNHISKIASGTFSWLGQLR 435

  Fly   501 ELDLSYNNIS---------SLGYEDLAFLSQNRLHVNMTHNK-----------IRRIALPEDVHL 545
            .|||..|.|.         .||.....:||.|: ::.:|...           :||:||..    
  Rat   436 ILDLGLNEIEQELTGQEWRGLGNIFEIYLSYNK-YLQLTSKSFTLVPSLQRLMLRRVALKS---- 495

  Fly   546 GEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQ-FKLRTDRLVCSQPNVLEGTPVR 609
                      ||::.:|.                 :|.|:.. ..|..:.:.....::|||....
  Rat   496 ----------VDISPSPF-----------------RPLYNLTILDLSNNNIANLNEDLLEGLENL 533

  Fly   610 QIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELH 674
            :|        |||..           |...|.:..|    ...|.:..:..|.:||      .|:
  Rat   534 EI--------LDFQH-----------NNLARLWKHA----NPGGPVNFLKGLSHLH------ILN 569

  Fly   675 LENNTLLRLPSANTPGYESVTSLHLAGNNLT----SIDVDQLPTNLTHLDISWNHLQMLNATVLG 735
            ||:|.|..:|.........:.|::|..|||.    ||..||  |:|..|::..|.:..:..:|.|
  Rat   570 LESNGLDEIPVKVFKNLFELKSINLGLNNLNTLLPSIFDDQ--TSLRSLNLQKNLITSVEKSVFG 632

  Fly   736 --FLNRTMKWRSVKLSGNPWMCDCTAKPLLLF------TQDNFERIGDRNEMMCVNAE----MPT 788
              |.|    ..|:.:|.||:  |||.:.:..|      |..|...:.  ...:|...:    :|.
  Rat   633 PAFHN----LNSLDMSFNPF--DCTCESIAWFVTWLNQTHTNIPELS--THYLCNTPQRYHGLPV 689

  Fly   789 RMVELST-NDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQ-TEIKI-WLYAHNLLLWFVTE 850
            ::.:.|: .|..|.:      |..:|..:.||....|.|...|: ..|.. |..:.:.:|.|...
  Rat   690 KLFDTSSCKDSAPFQ------LLFIINTSTLLTFILAVLLIHFEGWRISFYWNVSVHRILGFKEI 748

  Fly   851 EDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSR 915
            :...:..::.|:|.::.||:.::.::..| :|...|..:.|:.|||:..|....|.|:.|:..||
  Rat   749 DAQGEQFEYTAYIIHAQKDRDWVWEHFSP-MEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRSR 812

  Fly   916 RTIIVLSQNFIKSEWARLEFRAAH--RSALNEGRSRIIVIIYSDIGDVEKLDEEL---KAYLKMN 975
            :.|.|::.:.:|....| .|:..|  :.|:.:....||:|...:|.|. ||:..|   :...|.:
  Rat   813 KIIFVITHHLLKDPLCR-RFKVHHAVQQAIEQNLDSIILIFLQNIPDY-KLNHALCLRRGMFKSH 875

  Fly   976 TYLKWGDP-------WFWDKLRFALPHR 996
            ..|.|  |       .|..||:.||..|
  Rat   876 CILNW--PIQKERINAFHHKLQVALGSR 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/61 (28%)
leucine-rich repeat 176..198 CDD:275380 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 109/412 (26%)
LRR_8 221..281 CDD:290566 16/60 (27%)
leucine-rich repeat 223..270 CDD:275380 12/47 (26%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 6/26 (23%)
leucine-rich repeat 321..343 CDD:275380 11/59 (19%)
LRR_8 342..402 CDD:290566 26/62 (42%)
leucine-rich repeat 344..367 CDD:275380 10/25 (40%)
leucine-rich repeat 368..391 CDD:275380 9/23 (39%)
LRR_8 390..450 CDD:290566 19/69 (28%)
leucine-rich repeat 392..415 CDD:275380 7/23 (30%)
leucine-rich repeat 416..439 CDD:275380 6/32 (19%)
leucine-rich repeat 440..474 CDD:275380 13/50 (26%)
leucine-rich repeat 475..498 CDD:275380 8/23 (35%)
LRR_8 477..534 CDD:290566 20/77 (26%)
leucine-rich repeat 499..520 CDD:275380 9/30 (30%)
leucine-rich repeat 523..552 CDD:275380 6/40 (15%)
LRRCT 561..619 CDD:214507 8/59 (14%)
LRRNT 631..667 CDD:214470 7/36 (19%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 19/61 (31%)
leucine-rich repeat 694..715 CDD:275380 10/25 (40%)
leucine-rich repeat 716..737 CDD:275380 6/23 (26%)
LRRCT 751..800 CDD:214507 12/60 (20%)
TIR 858..996 CDD:214587 41/150 (27%)
Tlr3NP_942086.1 leucine-rich repeat 37..53 CDD:275380 8/30 (27%)
leucine-rich repeat 54..77 CDD:275380 7/27 (26%)
LRR_8 76..136 CDD:290566 14/60 (23%)
leucine-rich repeat 78..101 CDD:275380 4/23 (17%)
leucine-rich repeat 102..125 CDD:275380 9/23 (39%)
LRR_8 124..210 CDD:290566 21/96 (22%)
leucine-rich repeat 126..149 CDD:275380 3/23 (13%)
leucine-rich repeat 150..199 CDD:275380 14/59 (24%)
LRR_RI <192..452 CDD:238064 74/261 (28%)
leucine-rich repeat 200..250 CDD:275380 9/50 (18%)
leucine-rich repeat 251..276 CDD:275380 10/25 (40%)
LRR_8 275..330 CDD:290566 20/55 (36%)
leucine-rich repeat 277..300 CDD:275380 9/23 (39%)
LRR_8 299..388 CDD:290566 21/89 (24%)
leucine-rich repeat 301..322 CDD:275380 6/21 (29%)
leucine-rich repeat 325..381 CDD:275380 12/56 (21%)
leucine-rich repeat 382..407 CDD:275380 6/25 (24%)
leucine-rich repeat 410..433 CDD:275380 8/23 (35%)
LRR_8 412..468 CDD:290566 19/56 (34%)
LRR_RI 434..646 CDD:238064 62/279 (22%)
leucine-rich repeat 434..458 CDD:275380 9/24 (38%)
leucine-rich repeat 459..482 CDD:275380 4/24 (17%)
LRR_8 481..543 CDD:290566 18/112 (16%)
leucine-rich repeat 483..508 CDD:275380 9/56 (16%)
leucine-rich repeat 509..532 CDD:275380 4/23 (17%)
leucine-rich repeat 533..564 CDD:275380 9/54 (17%)
leucine-rich repeat 565..586 CDD:275380 8/27 (30%)
leucine-rich repeat 589..612 CDD:275380 10/25 (40%)
leucine-rich repeat 613..631 CDD:275380 4/18 (22%)
LRRCT 646..698 CDD:214507 11/56 (20%)
TIR 756..901 CDD:214587 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.