DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr12

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_008762370.1 Gene:Tlr12 RGDID:1559145 Length:956 Species:Rattus norvegicus

Alignment Length:921 Identity:191/922 (21%)
Similarity:317/922 (34%) Gaps:312/922 (34%)


  Fly   177 SHLEL------RANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHN 235
            :|.||      |:.|..:.........:||::......|.::|.|....||:|::|||..|||.:
  Rat   267 AHFELQGLNVDRSKIGNISQEALASCHSLETLSLSDTGLTKLPPGFLAAMPRLRRLNLAGNQLQS 331

  Fly   236 LTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRL 300
            ..            :.:::.|      ||    :.::.::||.|..|.||...|....||.|:.|
  Rat   332 TM------------LCMNETG------DV----SGLSTLDLSGNGLRILPPATFSCLPHLRELLL 374

  Fly   301 MNNRVPLATLPSRLFANQPELQILRL-RAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEH 364
            .:|:  |.:|....|.:..:|:.|:| |..|                ::||.|.|..|||     
  Rat   375 QDNQ--LLSLEGHPFQDLQQLETLKLDRNPL----------------LNLGKNCLAALPA----- 416

  Fly   365 QVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTI 429
               |.:|.|.:.::.|.||:.|....:|..|.|.   |..:|.....:|...:|           
  Rat   417 ---LTTLSLLDTQILHSPDAGFWGARSLHTLHLS---LPPLSAPAVLSLPMYLT----------- 464

  Fly   430 DSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKN 494
             |.....|.||:|..|..|..    |.|:.:   .||.     .| |.|.::|.|.:|.      
  Rat   465 -SLELHVTPGLKHWTLSPNIF----PFLETL---TING-----RG-LKLGVQNASEVFP------ 509

  Fly   495 TMLQLRELDLSYNNISSLGYEDLA--FLSQ----NRLHV-------------------NMTHNKI 534
               .|:.|.|..|::.:...:|.:  ||.|    ..|.|                   .:....:
  Rat   510 ---ALQHLFLLQNSLDAFCSQDASSIFLWQLPKLQSLKVWGAGSNSRPCLITGLPSLQELKLESL 571

  Fly   535 RRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQL----VRGVHKPQYSRQFKLRTDRL 595
            :.|..|..|.|.|               ||.|...|..:||    ::.:....:.|...|:...|
  Rat   572 QSITQPRSVQLEE---------------LVGDLPQ
LQALQLSSTGLKSLSAAAFRRLHSLQALVL 621

  Fly   596 VCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR 660
            ...:..||:.: :|:..||                .||    :|......|...|.:.       
  Rat   622 DSEKDLVLQDS-LREYSPQ----------------MPR----YVYILQSKLACQCANA------- 658

  Fly   661 LPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNH 725
                     .|||.::.:|              .|.:|:...:|...:| ::|...:.:...|:|
  Rat   659 ---------WMELWVKQST--------------KTYVHIRDGHLCPGEV-RVPARDSLISFLWDH 699

  Fly   726 LQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRM 790
                                         |..|.: |.||...:                     
  Rat   700 -----------------------------CPQTLE-LKLFLASS--------------------- 713

  Fly   791 VELSTNDICPAEKGVFIALAVVIALTGLLAG-------FTAALYYKFQTEIKIWLYAHNLLLWFV 848
                             ||.:::.:..||.|       :..||:       :|||..      ..
  Rat   714 -----------------ALVLLLIVLPLLQGARNTWIPYLRALF-------RIWLQG------LR 748

  Fly   849 TEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLE---HGPQKFQLCVHERDWLVGGHIPENIMRS 910
            .:.:..|...||.|:|:..:||.::.:.|:|.||   ......:||:.|||:..|..:.:|::.|
  Rat   749 GQGNAGKRFLFDVFVSHCRQDQGWVLEELLPALEGFLPAGLGLRLCLPERDFEPGKDVVDNVVDS 813

  Fly   911 VADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLD-EELKAYLKM 974
            :..||.|:.|||...:.:....||.|.|....|......::::::     :|.:. .:|.:|.::
  Rat   814 MVSSRVTLCVLSGPALCNPRCCLELRLATSLLLAAPSPPVLLLVF-----LEPISRHQLPSYHRL 873

  Fly   975 NTYLKWGDPWFWDKLRFALPHRRPV-------------GNIGNGALIKTALKGSTD--DKLELIK 1024
            ...|:.||...|.:     ...|.|             ||.|       .:.|..:  .||..:.
  Rat   874 ARLLRRGDYCLWPE-----EEERKVEKEDAEGKAGAEGGNSG-------GMLGRREGFPKLWSLG 926

  Fly  1025 PSPVTPPLTTP 1035
            |..|.|.|.||
  Rat   927 PGQVQPDLHTP 937

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 18/62 (29%)
leucine-rich repeat 176..198 CDD:275380 5/27 (19%)
leucine-rich repeat 199..222 CDD:275380 7/23 (30%)
LRR_RI 216..542 CDD:238064 82/352 (23%)
LRR_8 221..281 CDD:290566 14/60 (23%)
leucine-rich repeat 223..270 CDD:275380 10/47 (21%)
leucine-rich repeat 271..294 CDD:275380 7/23 (30%)
leucine-rich repeat 295..320 CDD:275380 7/25 (28%)
leucine-rich repeat 321..343 CDD:275380 5/23 (22%)
LRR_8 342..402 CDD:290566 17/60 (28%)
leucine-rich repeat 344..367 CDD:275380 7/23 (30%)
leucine-rich repeat 368..391 CDD:275380 7/23 (30%)
LRR_8 390..450 CDD:290566 14/60 (23%)
leucine-rich repeat 392..415 CDD:275380 6/23 (26%)
leucine-rich repeat 416..439 CDD:275380 3/23 (13%)
leucine-rich repeat 440..474 CDD:275380 8/34 (24%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 14/82 (17%)
leucine-rich repeat 499..520 CDD:275380 6/23 (26%)
leucine-rich repeat 523..552 CDD:275380 7/48 (15%)
LRRCT 561..619 CDD:214507 14/62 (23%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 4/29 (14%)
LRR_8 669..726 CDD:290566 11/57 (19%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 2/21 (10%)
LRRCT 751..800 CDD:214507 5/49 (10%)
TIR 858..996 CDD:214587 36/142 (25%)
Tlr12XP_008762370.1 leucine-rich repeat 71..93 CDD:275380
leucine-rich repeat 94..116 CDD:275380
leucine-rich repeat 117..144 CDD:275380
leucine-rich repeat 202..225 CDD:275380
leucine-rich repeat 226..270 CDD:275380 1/3 (33%)
leucine-rich repeat 246..259 CDD:275381
LRR_8 270..329 CDD:290566 17/59 (29%)
leucine-rich repeat 271..294 CDD:275380 3/23 (13%)
LRR_4 294..331 CDD:289563 14/37 (38%)
leucine-rich repeat 295..318 CDD:275380 7/23 (30%)
leucine-rich repeat 319..344 CDD:275380 10/47 (21%)
LRR_8 343..403 CDD:290566 19/62 (31%)
LRR_RI 345..547 CDD:238064 68/265 (26%)
leucine-rich repeat 345..368 CDD:275380 7/23 (30%)
leucine-rich repeat 369..392 CDD:275380 7/25 (28%)
leucine-rich repeat 393..416 CDD:275380 11/39 (28%)
leucine-rich repeat 417..437 CDD:275380 7/20 (35%)
leucine-rich repeat 441..510 CDD:275380 24/106 (23%)
leucine-rich repeat 511..562 CDD:275380 10/51 (20%)
leucine-rich repeat 563..591 CDD:275380 8/43 (19%)
leucine-rich repeat 592..615 CDD:275380 4/23 (17%)
TIR 759..886 CDD:214587 36/132 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.