DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and CG18480

DIOPT Version :10

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:214 Identity:62/214 - (28%)
Similarity:91/214 - (42%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 KTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTL 419
            |.|.:..:|....:..||||.|.:|.:.|..|..|.:|.:|.|..|.:..:.||.|..|..|..|
  Fly    63 KRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYL 127

  Fly   420 VMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDL--QQPLLDIMLQTQINSPFGYMHGLLTLNLRN 482
            .:|.|||..||.....|.|.|.||:|:.|.:..  :.|:|        .||     .|.:|||||
  Fly   128 DLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPIL--------RSP-----SLRSLNLRN 179

  Fly   483 NSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGE 547
            :.:..:.....:.:.|||:|||:.|.:.:|.                          |.|.|.  
  Fly   180 SQVNQLGTQLLSALPQLRQLDLAQNLLLTLS--------------------------PGDFHA-- 216

  Fly   548 GYNNNLVHVDLNDNPLVCD 566
              ..||..:::.:||..||
  Fly   217 --PRNLASLNVEENPFNCD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:404697
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR 222..576 CDD:443914 62/214 (29%)
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380 3/11 (27%)
leucine-rich repeat 368..391 CDD:275380 9/22 (41%)
leucine-rich repeat 392..415 CDD:275380 8/22 (36%)
leucine-rich repeat 416..439 CDD:275380 9/22 (41%)
leucine-rich repeat 440..474 CDD:275380 9/35 (26%)
leucine-rich repeat 475..498 CDD:275380 6/22 (27%)
leucine-rich repeat 499..520 CDD:275380 7/20 (35%)
leucine-rich repeat 523..552 CDD:275380 3/28 (11%)
LRRCT 561..619 CDD:214507 4/6 (67%)
LRRNT 631..667 CDD:214470
PPP1R42 <660..752 CDD:455733
leucine-rich repeat 664..693 CDD:275380
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
CG18480NP_609761.1 LRR <66..>230 CDD:443914 57/206 (28%)
leucine-rich repeat 76..99 CDD:275380 9/22 (41%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 9/35 (26%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.