DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Toll-4

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster

Alignment Length:1129 Identity:299/1130 (26%)
Similarity:483/1130 (43%) Gaps:245/1130 (22%)


  Fly    23 PGSEASFGRDACSEMSIDGLCQCAPIMSEY-EIICPANAENPTFRLT---IQPKDY------VQI 77
            || |...|...||    :||   ..|..:| ||......||.|..:.   :..:||      :::
  Fly    71 PG-EMRMGDINCS----NGL---GNIREDYCEIYLDELGENGTCSIANNEVTTEDYQMKLVFLKL 127

  Fly    78 MCNLT-------------DTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGI--VS- 126
            ..|.|             :.|||:.:...: :|....|.||      .:|....|..|||  :| 
  Fly   128 EINWTSPVFHGWNIFKICNETDYELVIISV-LGIRSEVDMR------ISPAVQYLSLLGIREISG 185

  Fly   127 -----PTTLIFESDNLGMNITRQHLDRLHGLKRFRF-----------TTRRLTHIPANLLTDMRN 175
                 |:.||.|.|          :...:|.|...|           .|........|....::.
  Fly   186 YDIYLPSVLITEMD----------VHHANGPKMVTFKYLYDSTVNSVITNNYIRKTMNNTEKIKI 240

  Fly   176 LSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQL---NLWSNQLHNLT 237
            ..|.........|..::|.....:.::.|...|::.:....|..:..|..|   |::...|..|.
  Fly   241 YYHNTFEKTTLTMEKNIFHGKNKMSALIFNGLKIKGLTNNTFENLTSLNTLIFDNVFLKDLSFLR 305

  Fly   238 KHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLS-----ANLFRSLPQGLFDHNKH--- 294
            ....:.:.:...:.: ||.::....:.|   ||:..|.:|     .|....:.:....|.|.   
  Fly   306 SSTLQSSLTYCIMKV-DNMVDLKSFEKF---TNLEIIEVSQYKGFKNFTAFICEPYKSHCKFTLG 366

  Fly   295 LNEV------RLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNL 353
            :|||      ....||            ::.:|:|...:..|.::| .|.......:.:....||
  Fly   367 INEVACPLKCNCSYNR------------DKSQLEIDCWQKNLTTIP-SLPVPKKGSSALVFQSNL 418

  Fly   354 LKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISG---------DI 409
            |..||...||...||.|||:|.|:||.|..|....:.:..|:|  .|.:|.:|.         ::
  Fly   419 LAELPDNSLEGYHNLKSLDVSYNQLTSLSVSQLPESLHYLDIR--HNKITTLSPQVVEYLYSVNV 481

  Fly   410 FSNLGN------------------LVTLVMSRNRLRTIDSRAFVSTNG----------LRHLHLD 446
            |:..||                  ...|.:..::.:||.....:|:.|          :..|:|:
  Fly   482 FNQYGNKWSIYCDEYHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNIDQLYLE 546

  Fly   447 HND---------------IDLQQPL----------LDIMLQTQINSP--------FGYMHGLLTL 478
            .|:               :.|.:.|          .|.::...:|||        |.:..|...:
  Fly   547 ANEDEIIDAFGPSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSCCFEWHTGEFLI 611

  Fly   479 NLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSL-GYEDLAFLSQNRLH-VNMTHNKIRRI---A 538
            |.||.| :.:|....|::.....|.|..|.|..| ..|.|.......:| ::|:.|.:|.:   .
  Fly   612 NCRNLS-LDIYPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQNLLRELPLHL 675

  Fly   539 LPEDV-----------HLGEG------YNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSR 586
            |||::           :|.:|      |..|:..::|:.||..|:|....|:..:|. |:|    
  Fly   676 LPENITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECNCKAKAFLSFLRR-HEP---- 735

  Fly   587 QFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDK---ALVI 648
                                    :|.:|::..::.:||    |||..|.|.|.|.:.   |.|:
  Fly   736 ------------------------MEYETVLRRVEITDD----KCPEDCICCVDTSNSDSLAYVV 772

  Fly   649 NCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLP 713
            :|....|:.:|:||.  .......|..|.|:|.:.||:..|||.|||..:||.|.|:  |:||||
  Fly   773 DCSGKELSEIPQLPT--PTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLS--DIDQLP 833

  Fly   714 TNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLS--GNPWMCDCTAKPLLLFTQDNFERIGDR 776
            ..|.:||||.|:...|:..|.|||.:.|....::||  ||||.|.|..|..|:|.::..:.|.:.
  Fly   834 DKLEYLDISNNNFSALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEDKDFLVFVKEQAKNIANA 898

  Fly   777 NEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAH 841
            :.:.|:  :....::|:...||||:....:.:|||.:    |:...:..::..|:..|.||.|.|
  Fly   899 SAIQCI--DTGRSLIEVEETDICPSVLIYYTSLAVSL----LIIALSINVFICFRQPIMIWFYEH 957

  Fly   842 NLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPEN 906
            .:.|......:||:|||:|||:|::|||:..||:: |.:||:|..||:||.:.||||||..||:.
  Fly   958 EICLSLAARRELDEDKKYDAFLSFTHKDEDLIEEF-VDRLENGRHKFRLCFYLRDWLVGESIPDC 1021

  Fly   907 IMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAY 971
            |.:||..|||.||::::||:||.|.|||||.|..:...:...|:||::|.|:...:.||.||:||
  Fly  1022 INQSVKGSRRIIILMTKNFLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLDSELRAY 1086

  Fly   972 LKMNTYLKWGDPWFWDKLRFALPH 995
            :.:||||...:|.||:||.:::||
  Fly  1087 MVLNTYLDRNNPNFWNKLMYSMPH 1110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 9/62 (15%)
leucine-rich repeat 176..198 CDD:275380 3/22 (14%)
leucine-rich repeat 199..222 CDD:275380 3/23 (13%)
LRR_RI 216..542 CDD:238064 88/418 (21%)
LRR_8 221..281 CDD:290566 13/68 (19%)
leucine-rich repeat 223..270 CDD:275380 9/50 (18%)
leucine-rich repeat 271..294 CDD:275380 5/28 (18%)
leucine-rich repeat 295..320 CDD:275380 5/31 (16%)
leucine-rich repeat 321..343 CDD:275380 5/22 (23%)
LRR_8 342..402 CDD:290566 21/60 (35%)
leucine-rich repeat 344..367 CDD:275380 7/23 (30%)
leucine-rich repeat 368..391 CDD:275380 10/23 (43%)
LRR_8 390..450 CDD:290566 16/112 (14%)
leucine-rich repeat 392..415 CDD:275380 7/32 (22%)
leucine-rich repeat 416..439 CDD:275380 4/23 (17%)
leucine-rich repeat 440..474 CDD:275380 10/67 (15%)
leucine-rich repeat 475..498 CDD:275380 6/23 (26%)
LRR_8 477..534 CDD:290566 16/59 (27%)
leucine-rich repeat 499..520 CDD:275380 7/22 (32%)
leucine-rich repeat 523..552 CDD:275380 10/50 (20%)
LRRCT 561..619 CDD:214507 10/58 (17%)
LRRNT 631..667 CDD:214470 13/39 (33%)
leucine-rich repeat 664..693 CDD:275380 9/29 (31%)
LRR_8 669..726 CDD:290566 27/57 (47%)
leucine-rich repeat 694..715 CDD:275380 11/21 (52%)
leucine-rich repeat 716..737 CDD:275380 10/21 (48%)
LRRCT 751..800 CDD:214507 14/49 (29%)
TIR 858..996 CDD:214587 67/139 (48%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380 3/23 (13%)
leucine-rich repeat 288..308 CDD:275380 5/20 (25%)
leucine-rich repeat 309..334 CDD:275380 4/29 (14%)
leucine-rich repeat 335..386 CDD:275380 10/63 (16%)
leucine-rich repeat 388..408 CDD:275380 4/21 (19%)
LRR_8 412..465 CDD:290566 21/55 (38%)
leucine-rich repeat 412..432 CDD:275378 7/20 (35%)
LRR_4 432..470 CDD:289563 16/40 (40%)
leucine-rich repeat 433..454 CDD:275378 10/21 (48%)
leucine-rich repeat 455..478 CDD:275378 5/25 (20%)
leucine-rich repeat 479..490 CDD:275378 3/11 (27%)
leucine-rich repeat 632..657 CDD:275378 7/25 (28%)
leucine-rich repeat 658..679 CDD:275378 7/21 (33%)
leucine-rich repeat 680..706 CDD:275378 3/26 (12%)
leucine-rich repeat 707..719 CDD:275378 3/12 (25%)
leucine-rich repeat 771..791 CDD:275380 6/22 (27%)
leucine-rich repeat 793..815 CDD:275378 9/22 (41%)
leucine-rich repeat 816..835 CDD:275378 11/21 (52%)
leucine-rich repeat 836..859 CDD:275378 11/23 (48%)
TIR 974..1110 CDD:214587 66/137 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19498993
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24365
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.