DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr2

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_942064.1 Gene:Tlr2 RGDID:735138 Length:784 Species:Rattus norvegicus

Alignment Length:966 Identity:216/967 (22%)
Similarity:359/967 (37%) Gaps:287/967 (30%)


  Fly   111 GHTPIASI-LDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMR 174
            ||:..||: .|..|:...::..|.|...|:....:.||         .:..::|:|....|....
  Rat    21 GHSAQASLSCDAAGVCDGSSRSFTSIPSGLTANTKKLD---------LSFNKITYIGHGDLRACV 76

  Fly   175 NLSHLELRAN-IEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTK 238
            ||..|.|.:: |..:....|..|.:||.::..:|.|..:....|..:..||.|||..|....|  
  Rat    77 NLRVLTLESSGINTIEGDAFYSLGSLEHLDLSNNHLSSLSSSWFRPLSSLKYLNLMGNPYRTL-- 139

  Fly   239 HDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNN 303
                |.||                 :|::|||:          ::|..|..|   ..:|:|    
  Rat   140 ----GETS-----------------LFSNLTNL----------QTLRVGNVD---TFSEIR---- 166

  Fly   304 RVPLATLPSRLFANQPELQILRL----RAELQSLPGDLFEHSTQIT----------NISLGDNLL 354
            |:..|.|.|   .|:.|:|:|.|    ...|||: .|::..:..::          :|......|
  Rat   167 RIDFAGLTS---LNELEIQVLSLGNYESRSLQSI-RDIYHLTLHLSESAFLLGIFADILSSVRYL 227

  Fly   355 KTLPATLLEHQVNLLSLDLSNN-------RLTHLPD-------SLFAHTTNLTDLRLEDNLLTGI 405
            :.....|...|.:.||:|..|:       |...|.|       .|..:...|.::..:...|.|:
  Rat   228 ELRDTNLARFQFSELSVDEINSPMKKLAFRNADLTDKSFNELLKLLRYILELMEVEFDHCTLNGV 292

  Fly   406 ------SGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQ 464
                  ..|:...||.:.|:.                   :|.||:.           ...|...
  Rat   293 GNFNPSESDVVRELGKVETVT-------------------IRSLHIP-----------QFYLFYD 327

  Fly   465 INSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLS---------YNNISSLGYEDL--A 518
            :::.:..:..:..:.:.|:.:..|...:...:..|..||||         .|:....|:..|  .
  Rat   328 LSTVYSLLEKVKRITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACEGGWPSLQSL 392

  Fly   519 FLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDN---PLVCDCTILWFIQLVRGVH 580
            .||||.|      ..||:.|   ::.|   ...||..:|::.|   |:...|.  |         
  Rat   393 VLSQNHL------RSIRKTA---EILL---TLKNLTALDISKNSFQPMPDSCQ--W--------- 434

  Fly   581 KPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKA 645
             |...|...|.:..:          ..|:...||||.. ||.|::                    
  Rat   435 -PGKMRFLNLSSTGI----------QAVKTCIPQTLEV-LDVSNN-------------------- 467

  Fly   646 LVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVD 710
               |..|.:| .:||         |.||::..|.|..||.|:.  :..:..:.:..|.:::...|
  Rat   468 ---NLDSFSL-FLPR---------LQELYISRNKLKTLPEASL--FPVLQVMKIRENAISTFSKD 517

  Fly   711 QLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFER--- 772
            ||.        |:..|:.|.|                 ..|.::|.|.....:|      ||   
  Rat   518 QLG--------SFPKLETLEA-----------------GDNHFICSCELLSFIL------ERPAL 551

  Fly   773 ----IGDRNEMMCVNAEMPTRMVELSTNDICPA---------EKGVFIALAVVIALTGLLAGFTA 824
                :...:..:|   :.|.|:......|..|:         ..||..||.::|.|.|       
  Rat   552 VHVLVDWPDSYLC---DSPPRLHGQRLQDARPSVLECHQAALVSGVCCALLLLILLLG------- 606

  Fly   825 ALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKK-------FDAFISYSHKDQSFIEDYLVPQLE 882
            ||.|.|.   .:| |...:..|...:.   |.||       :|||:|||.:|..::|:.:|.|||
  Rat   607 ALCYHFH---GLW-YLRMMWAWLRAKR---KPKKAPCRDLCYDAFVSYSEQDSYWVENLMVQQLE 664

  Fly   883 HGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGR 947
            :....|:||:|:||::.|..|.:||:.|:..|.:|:.|||:||::|||.:.|...:|....:|..
  Rat   665 NSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVRSEWCKYELDFSHFRLFDENN 729

  Fly   948 SRIIVIIYSDIGDVEKLDE---ELKAYLKMNTYLKWGDPW-------FWDKLRFAL 993
            ...|:::...| :.:.:.:   :|:..:...|||:|  |.       ||..||.|:
  Rat   730 DAAILVLLEPI-EKKAIPQRFCKLRKIMNTKTYLEW--PLDEGQREVFWANLRTAI 782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 18/60 (30%)
leucine-rich repeat 176..198 CDD:275380 6/23 (26%)
leucine-rich repeat 199..222 CDD:275380 5/23 (22%)
LRR_RI 216..542 CDD:238064 74/371 (20%)
LRR_8 221..281 CDD:290566 14/60 (23%)
leucine-rich repeat 223..270 CDD:275380 13/47 (28%)
leucine-rich repeat 271..294 CDD:275380 3/23 (13%)
leucine-rich repeat 295..320 CDD:275380 7/25 (28%)
leucine-rich repeat 321..343 CDD:275380 7/26 (27%)
LRR_8 342..402 CDD:290566 13/84 (15%)
leucine-rich repeat 344..367 CDD:275380 4/33 (12%)
leucine-rich repeat 368..391 CDD:275380 8/37 (22%)
LRR_8 390..450 CDD:290566 10/66 (15%)
leucine-rich repeat 392..415 CDD:275380 6/29 (21%)
leucine-rich repeat 416..439 CDD:275380 1/23 (4%)
leucine-rich repeat 440..474 CDD:275380 4/34 (12%)
leucine-rich repeat 475..498 CDD:275380 2/23 (9%)
LRR_8 477..534 CDD:290566 15/68 (22%)
leucine-rich repeat 499..520 CDD:275380 8/32 (25%)
leucine-rich repeat 523..552 CDD:275380 6/29 (21%)
LRRCT 561..619 CDD:214507 12/61 (20%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 13/57 (23%)
leucine-rich repeat 694..715 CDD:275380 4/21 (19%)
leucine-rich repeat 716..737 CDD:275380 4/21 (19%)
LRRCT 751..800 CDD:214507 10/56 (18%)
TIR 858..996 CDD:214587 50/154 (32%)
Tlr2NP_942064.1 leucine-rich repeat 57..77 CDD:275380 5/29 (17%)
LRR_8 77..135 CDD:290566 18/58 (31%)
leucine-rich repeat 78..101 CDD:275380 6/23 (26%)
leucine-rich repeat 102..125 CDD:275380 5/23 (22%)
leucine-rich repeat 126..150 CDD:275380 13/47 (28%)
leucine-rich repeat 151..175 CDD:275380 8/41 (20%)
leucine-rich repeat 182..202 CDD:275380 7/21 (33%)
leucine-rich repeat 203..223 CDD:275380 1/20 (5%)
LRR_RI <324..535 CDD:238064 60/306 (20%)
leucine-rich repeat 362..388 CDD:275380 7/26 (27%)
LRR_8 387..448 CDD:290566 20/85 (24%)
leucine-rich repeat 389..414 CDD:275380 10/37 (27%)
leucine-rich repeat 415..437 CDD:275380 7/34 (21%)
leucine-rich repeat 438..458 CDD:275380 5/30 (17%)
leucine-rich repeat 459..478 CDD:275380 8/44 (18%)
LRR_8 477..535 CDD:290566 19/94 (20%)
leucine-rich repeat 479..500 CDD:275380 8/23 (35%)
leucine-rich repeat 501..524 CDD:275380 5/31 (16%)
LRRCT 533..586 CDD:214507 11/62 (18%)
TIR 640..784 CDD:214587 49/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.