DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr10

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001139507.1 Gene:Tlr10 RGDID:1311569 Length:811 Species:Rattus norvegicus

Alignment Length:915 Identity:194/916 (21%)
Similarity:343/916 (37%) Gaps:234/916 (26%)


  Fly   173 MRNLSHLELRANI----EEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQL 233
            ||.:|.:....||    |.......|:.|.:.:  :.:..||::|..:   .|....|:|..|.|
  Rat     1 MRLISSIYTLYNIIMSTEAWAPRPTDERELISN--YSNMALRKVPPDV---TPATTILDLSYNLL 60

  Fly   234 HNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEV 298
            :.....||...:.:..:.:..|.|:||...:|.....::.::||.|..:|:........:||:  
  Rat    61 YQFQSSDFHSFSKLRFLILCHNSIQQLDTKIFDLNKELSYLDLSYNRLQSITWSSLVDLRHLD-- 123

  Fly   299 RLMNNRVPLATLPS-RLFANQPELQILRL------RAELQSLPGDLFEHSTQITNISLGDNLLKT 356
             |..|  ...|||: ....|...|:.|.|      |::||.:.      :.|.:.:.:|.|    
  Rat   124 -LSFN--DFDTLPACEEIGNMRHLETLGLSGAKIQRSDLQKIA------NLQFSTVFIGLN---- 175

  Fly   357 LPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVM 421
               ||..::..  ||.:.|..:.|:...:.|:...|    |.|.:.|....:: ||:|       
  Rat   176 ---TLSHYEEG--SLPVLNTTVLHIVLPMAANFWVL----LCDGMKTSKVVEM-SNIG------- 223

  Fly   422 SRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIML-------QTQI------NSPFGYMH 473
            .:::..:.::...:|....:...|..:.:||   |.|.:|       ||.:      :..||.|.
  Rat   224 GKSQFVSYETPRTLSVENTKASTLIFHKVDL---LWDDLLHVFQFVWQTSVECFQIQDLTFGGMA 285

  Fly   474 GLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIA 538
            .      |::|..    |:.||:::...|:       |:.:. :.|:.||::::..|...:..:.
  Rat   286 S------RDHSSF----DYSNTVMKAVILE-------SIHFR-IFFIPQNKIYLFFTQMDLENLT 332

  Fly   539 L-------------PEDV-HLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFK 589
            :             |:.. ||  .:.||::..||..||          ||:       .|.:...
  Rat   333 ISDAQMPHLLFPSHPQSFQHL--NFANNILTDDLFKNP----------IQM-------PYLKTLV 378

  Fly   590 LRTDRLV------------------CSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCN 636
            ||.::|.                  .||..:..|...:.:.|.|||.                .|
  Rat   379 LRGNQLETLSLVSLFANHTSLLHLDLSQNLLQHGNGEKCMWPDTLIL----------------LN 427

  Fly   637 CHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAG 701
            .....:|.: |..|             |.|::|.::|   ||..:|.........:|:..|.:|.
  Rat   428 LSSNKFDGS-VFRC-------------LPKSIQTLDL---NNNKIRAVPKEIIYLKSLRELSIAF 475

  Fly   702 NNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCT-------- 758
            |.||.:........|:.|:|..|   ::.:..|.|.....:.:::....||:.|.|.        
  Rat   476 NFLTDLPGCDHFKRLSSLNIEMN---LILSPSLDFFQSCQEVKTLNAGRNPFRCICEFRDFIWLE 537

  Fly   759 --AKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAEKG-----VFIALAVVIALT 816
              :|.|:....|::.            .|.|..:......|:...|..     :.:.:.:||.:.
  Rat   538 KHSKGLMSEWPDSYA------------CEYPLSLKGTPLKDVYLPELACNTTLLIVTIVLVILVL 590

  Fly   817 GLLAGFTAALYYKFQTEIKIWLYAHNLLLWFV----------------TEEDLDKDKKFDAFISY 865
            ||:..|   ...||.            :||::                ..|:..:..:|.|||||
  Rat   591 GLVVAF---CILKFD------------MLWYLRVLAQCIRTQHRVRKTVREERKRSVQFHAFISY 640

  Fly   866 SHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEW 930
            :..|..::::.|:|.||.......||:.||::.....|.|||:.....|.::|.|||.||:::.|
  Rat   641 AAHDSVWVKNELIPNLETEDGSVLLCLPERNFDPDRSIAENIISCTEKSYKSIFVLSPNFVQNGW 705

  Fly   931 ARLEFRAAHRSALNEGRSRIIVIIYSDIGD--VEKLDEELKAYLKMNTYLKWGDP-----WFWDK 988
            ...|...||.:...:....||.|:...|..  |.....:|||.|:...||:|...     .||..
  Rat   706 CHNELYLAHHNPFRDNYDYIIPILLEPIPSYCVPTKFPKLKALLEKKVYLEWPKDRRKHGLFWAN 770

  Fly   989 LRFAL 993
            ||.|:
  Rat   771 LRAAI 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 14/63 (22%)
leucine-rich repeat 176..198 CDD:275380 6/26 (23%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 71/359 (20%)
LRR_8 221..281 CDD:290566 15/60 (25%)
leucine-rich repeat 223..270 CDD:275380 11/47 (23%)
leucine-rich repeat 271..294 CDD:275380 4/23 (17%)
leucine-rich repeat 295..320 CDD:275380 7/26 (27%)
leucine-rich repeat 321..343 CDD:275380 6/28 (21%)
LRR_8 342..402 CDD:290566 13/60 (22%)
leucine-rich repeat 344..367 CDD:275380 4/23 (17%)
leucine-rich repeat 368..391 CDD:275380 5/23 (22%)
LRR_8 390..450 CDD:290566 9/60 (15%)
leucine-rich repeat 392..415 CDD:275380 7/23 (30%)
leucine-rich repeat 416..439 CDD:275380 1/23 (4%)
leucine-rich repeat 440..474 CDD:275380 11/47 (23%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 11/57 (19%)
leucine-rich repeat 499..520 CDD:275380 3/21 (14%)
leucine-rich repeat 523..552 CDD:275380 6/43 (14%)
LRRCT 561..619 CDD:214507 15/76 (20%)
LRRNT 631..667 CDD:214470 6/36 (17%)
leucine-rich repeat 664..693 CDD:275380 7/29 (24%)
LRR_8 669..726 CDD:290566 15/57 (26%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 6/21 (29%)
LRRCT 751..800 CDD:214507 10/59 (17%)
TIR 858..996 CDD:214587 47/144 (33%)
Tlr10NP_001139507.1 LRR_RI <39..167 CDD:238064 34/142 (24%)
leucine-rich repeat 50..73 CDD:275378 6/23 (26%)
LRR_8 72..129 CDD:290566 13/62 (21%)
leucine-rich repeat 74..97 CDD:275378 5/23 (22%)
leucine-rich repeat 98..118 CDD:275378 4/20 (20%)
leucine-rich repeat 119..143 CDD:275378 8/29 (28%)
leucine-rich repeat 144..155 CDD:275378 3/11 (27%)
LRR_RI <324..481 CDD:238064 40/209 (19%)
leucine-rich repeat 350..373 CDD:275380 10/42 (24%)
LRR_8 372..455 CDD:290566 21/116 (18%)
leucine-rich repeat 374..398 CDD:275380 3/24 (13%)
leucine-rich repeat 399..422 CDD:275380 4/23 (17%)
leucine-rich repeat 423..444 CDD:275380 8/51 (16%)
LRR_8 443..500 CDD:290566 16/63 (25%)
leucine-rich repeat 445..467 CDD:275380 5/25 (20%)
leucine-rich repeat 468..489 CDD:275380 5/21 (24%)
leucine-rich repeat 490..513 CDD:275380 6/26 (23%)
TPKR_C2 522..574 CDD:301599 11/64 (17%)
TIR 633..775 CDD:214587 47/142 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.